Description

  • Product name

    Recombinant Mouse Vitamin D Binding protein (His tag)
    See all Vitamin D Binding protein proteins and peptides
  • Purity

    > 85 % SDS-PAGE.

  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Mouse
    • Sequence

      LERGRDYEKDKVCNELAMLGKEDFRSLSLILYSRKFSSSTFEQVNQLVKE VVSLTEECCAEGADPTCYDTRTSELSVKSCESDAPFPVHPGTPECCTKEG LERKLCMAALSHQPQEFPTYVEPTNDEICEAFRRDPKGFADQFLYEYSSN YGQAPLPLLVAYTKNYLSMVGSCCTSANPTVCFVKERLQMKHLSLLTTMS NRVCSQYAAYGKEKSRLSHLIKLAQKVPTANLENVLPLAEDFTEILSRCC ESTSEDCMASELPEHTIKICQNLSKKNSKFEECCQENTPMNIFMCTYFMP AAEPLQLPAIKLPTGKDLCGQSTTQAMDQYTFELSRRTQVPEVFLSKVLE PTLKTLRECCDTQDSVACFSTQSPLLKRQLTSFIEKGQEMCADYSENTFT EYKKKLAERLRTKTPNTSPAELKDMVEKHSDFASKCCSINSPPLYCSSQI DAEMIDTLQS
    • Predicted molecular weight

      57 kDa including tags
    • Amino acids

      17 to 476
    • Tags

      His tag N-Terminus
    • Additional sequence information

      This product is the mature full length protein from aa 17 to 476. The signal peptide is not included.

Specifications

Our Abpromise guarantee covers the use of ab235708 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    Constituents: Tris buffer, 50% Glycerol

General Info

  • Alternative names

    • DBP
    • DBP/GC
    • GC
    • Gc globulin
    • Gc-globulin
    • GRD3
    • Group specific component
    • Group specific component vitamin D binding protein
    • Group-specific component
    • hDBP
    • VDB
    • VDBG
    • VDBP
    • Vitamin D binding alpha globulin
    • Vitamin D-binding protein
    • VTDB_HUMAN
    see all
  • Function

    Multifunctional protein found in plasma, ascitic fluid, cerebrospinal fluid, and urine and on the surface of many cell types. In plasma, it carries the vitamin D sterols and prevents polymerization of actin by binding its monomers. DBP associates with membrane-bound immunoglobulin on the surface of B-lymphocytes and with IgG Fc receptor on the membranes of T-lymphocytes.
  • Sequence similarities

    Belongs to the ALB/AFP/VDB family.
    Contains 3 albumin domains.
  • Cellular localization

    Secreted.
  • Information by UniProt

Images

  • ab235708 analyzed by (Tris-Glycine gel) discontinuous SDS-PAGE (reduced) analysis with 5% enrichment gel and 15% separation gel.

References

ab235708 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab235708.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up