Overview

Description

  • Nature

    Recombinant
  • Source

    CHO cells
  • Amino Acid Sequence
    • Accession
    • Species

      Mouse
    • Sequence

      MAPLGYLLVLCSLKQALGSYPIWWSLAVGPQYSSLSTQPILCASIPGLVP KQLRFCRNYVEIMPSVAEGVKAGIQECQ HQFRGRRWNCTTVSNSLAIF GPVLDKATRESAFVHAIASAGVAFAVTRSCAEGSAAICGCSSRLQGSPGE GWKWGGCSEDIEFGGMVSREFADARENRPDARSAMNRHNNEAGRQAIASH MHLKCKCHGLSGSCEVKTCWWSQPDFRTIGDFLKDKYDSASEMVVEKHRE SRGWVETLRP RYTYFKVPTERDLVYYEASPNFCEPNPETGSFGTRDRT CNVSSHGIDGCDLLCCGRGHNARTERRREKCHCVFHWCCYVSCQECTRVY DVHTCK
    • Molecular weight

      39 kDa
    • Amino acids

      1 to 352

Specifications

Our Abpromise guarantee covers the use of ab205620 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Biological activity

    Biological Activity: Wnt3a can induce β-catenin mediated response in a TCF/LEF reporter gene luciferase assay.

  • Applications

    Functional Studies

    SDS-PAGE

  • Endotoxin level

    < 1.000 Eu/µg
  • Purity

    > 80 % SDS-PAGE.

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on Dry Ice. Store at -80°C. Avoid freeze / thaw cycle.

    Constituents: 99% PBS, 1% CHAPS

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

General Info

  • Alternative names

    • Protein Wnt 3a Precursor
    • Protein Wnt-3a
    • Wingless type MMTV integration site family member 3A
    • Wnt 3a
    • wnt3a
    • WNT3A protein
    • WNT3A_HUMAN
    see all
  • Function

    Ligand for members of the frizzled family of seven transmembrane receptors. Wnt-3 and Wnt-3a play distinct roles in cell-cell signaling during morphogenesis of the developing neural tube.
  • Tissue specificity

    Moderately expressed in placenta and at low levels in adult lung, spleen, and prostate.
  • Sequence similarities

    Belongs to the Wnt family.
  • Cellular localization

    Secreted > extracellular space > extracellular matrix.
  • Information by UniProt

References

ab205620 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab205620.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up