Description

  • Product name

    Recombinant Mouse Wnt8b protein (Tagged)
  • Purity

    > 90 % SDS-PAGE.

  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Mouse
    • Sequence

      WSVNNFLMTGPKAYLVYSSSVAAGAQSGIEECKYQFAWDRWNCPERALQL SSHGGLRSANRETAFVHAISSAGVMYTLTRNCSLGDFDNCGCDDSRNGQL GGQGWLWGGCSDNVGFGEAISKQFVDALETGQDARAAMNLHNNEAGRKAV KGTMKRTCKCHGVSGSCTTQTCWLQLPEFREVGAHLKEKYHAALKVDLLQ GAGNSAAGRGAIADTFRSISTRELVHLEDSPDYCLENKTLGLLGTEGREC LRRGRALGRWERRSCRRLCGDCGLAVEERRAETVSSCNCKFHWCCAVRCE QCRRRVTKYFCSRAERPPRGAAHKPGKNS
    • Predicted molecular weight

      56 kDa including tags
    • Amino acids

      22 to 350
    • Tags

      His tag N-Terminus
    • Additional sequence information

      This product is the mature full length protein from aa 22 to 350 with a 10xHis-SUMO tag at the N-terminus and a Myc tag at the C-terminus. The signal peptide is not included.

Specifications

Our Abpromise guarantee covers the use of ab225973 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    Constituents: 50% Glycerol, Tris buffer

General Info

  • Alternative names

    • Protein Wnt-8b
    • Wingless related MMTV integration site 8b
    • Wingless type MMTV integration site family, member 8B
    • Wnt 8b
    • Wnt8 b
    • Wnt8b
    • WNT8B_HUMAN
    see all
  • Function

    Ligand for members of the frizzled family of seven transmembrane receptors. May play an important role in the development and differentiation of certain forebrain structures, notably the hippocampus.
  • Tissue specificity

    Expression is restricted to the brain, and more specifically to the forebrain.
  • Sequence similarities

    Belongs to the Wnt family.
  • Cellular localization

    Secreted > extracellular space > extracellular matrix.
  • Information by UniProt

References

ab225973 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab225973.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up