Description

  • Product name

    Recombinant Mycobacterium tuberculosis Ag85 protein (His tag)
    See all Mycobacterium tuberculosis Ag85 proteins and peptides
  • Purity

    > 85 % SDS-PAGE.

  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Mycobacterium tuberculosis
    • Sequence

      FSRPGLPVEYLQVPSPSMGRDIKVQFQSGGNNSPAVYLLDGLRAQDDYNG WDINTPAFEWYYQSGLSIVMPVGGQSSFYSDWYSPACGKAGCQTYKWETF LTSELPQWLSANRAVKPTGSAAIGLSMAGSSAMILAAYHPQQFIYAGSLS ALLDPSQGMGPSLIGLAMGDAGGYKAADMWGPSSDPAWERNDPTQQIPKL VANNTRLWVYCGNGTPNELGGANIPAEFLENFVRSSNLKFQDAYNAAGGH NAVFNFPPNGTHSWEYWGAQLNAMKGDLQSSLGAG
    • Predicted molecular weight

      36 kDa including tags
    • Amino acids

      41 to 325
    • Tags

      His tag N-Terminus
    • Additional sequence information

      Strain CDC 1551 / Oshkosh. This product is the mature full length protein from aa 41 to 325. The signal peptide is not included.
  • Description

    Recombinant Mycobacterium tuberculosis Mycobacterium tuberculosis Ag85 protein (His tag)

Specifications

Our Abpromise guarantee covers the use of ab236183 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    Constituents: Tris buffer, 50% Glycerol

General Info

  • Alternative names

    • Antigen 85 complex A
    • Antigen 85 complex B
    • Antigen 85 complex C
    • fbpA
    • fbpB
    • fbpC
    • Secreted antigen 85 A
    • Secreted antigen 85 B
    • Secreted antigen 85 C
    see all
  • Relevance

    Mycobacterium tuberculosis antigen 85 is a complex of three related gene products of 30-31 kDa, Ag85A, B and C. All three proteins show fibronectin binding properties and act as mycolyltransferases involved in the final stages of mycobacterial cell wall assembly.

Images

  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) analysis with 5% enrichment gel and 15% separation gel of ab236183.

References

ab236183 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab236183.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up