Recombinant Mycobacterium tuberculosis Hypoxic response protein 1 (Tagged) (ab238290)

Description

  • Product name

    Recombinant Mycobacterium tuberculosis Hypoxic response protein 1 (Tagged)
  • Purity

    > 90 % SDS-PAGE.

  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Mycobacterium tuberculosis
    • Sequence

      MTTARDIMNAGVTCVGEHETLTAAAQYMREHDIGALPICGDDDRLHGMLT DRDIVIKGLAAGLDPNTATAGELARDSIYYVDANASIQEMLNVMEEHQVR RVPVISEHRLVGIVTEADIARHLPEHAIVQFVKAICSPMALAS
    • Predicted molecular weight

      36 kDa including tags
    • Amino acids

      1 to 143
    • Additional sequence information

      N-terminal 10xHis-SUMO-tagged and C-terminal Myc-tagged. (Strain ATCC 25618 / H37Rv).

Specifications

Our Abpromise guarantee covers the use of ab238290 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Mass Spectrometry

    SDS-PAGE

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    Constituents: Tris buffer, 50% Glycerol

Images

  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel analysis of ab238290.

  • Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of ab238290 could indicate that this peptide derived from E.coli-expressed Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) Hypoxic response protein 1.

  • Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of ab238290 could indicate that this peptide derived from E.coli-expressed Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) Hypoxic response protein 1.

References

ab238290 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab238290.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up