Recombinant Mycobacterium tuberculosis MPT64 protein (His tag) (ab226277)

Overview

Description

  • Nature

    Recombinant
  • Source

    Yeast
  • Amino Acid Sequence
    • Accession
    • Species

      Mycobacterium tuberculosis
    • Sequence

      APKTYCEELKGTDTGQACQIQMSDPAYNINISLPSYYPDQKSLENYIAQT RDKFLSAATSSTPREAPYELNITSATYQSAIPPRGTQAVVLKVYQNAGGT HPTTTYKAFDWDQAYRKPITYDTLWQADTDPLPVVFPIVQGELSKQTGQQ VSIAPNAGLDPVNYQNFAVTNDGVIFFFNPGELLPEAAGPTQVLVPRSAI DSMLA
    • Molecular weight

      24 kDa including tags
    • Amino acids

      24 to 228
    • Tags

      His tag N-Terminus
    • Additional sequence information

      Strain CDC 1551 / Oshkosh. This product is the mature full length protein from aa 24 to 228. The signal peptide is not included.

Specifications

Our Abpromise guarantee covers the use of ab226277 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Mass Spectrometry

    SDS-PAGE

  • Mass spectrometry

    LC-MS/MS
  • Purity

    > 90 % SDS-PAGE.

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    Constituents: 50% Glycerol, Tris buffer

General Info

  • Alternative names

    • Antigen MPT64
    • immunogenic protein
    • immunogenic protein Mpt64
    • mpb64
    • MT2032
    • MTCY39.39
    • Rv1980c
    • simliar to Rv1980c of M. tuberculosis H37Rv
    see all
  • Cellular localization

    Secreted

Images

  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) analysis of ab226277 with 5% enrichment gel and 15% separation gel.

  • Based on the SEQUEST from database of Yeast host and target protein, the LC-MS/MS Analysis result of ab226277 could indicate that this peptide derived from Yeast-expressed Mycobacterium tuberculosis MPT64.

  • Based on the SEQUEST from database of Yeast host and target protein, the LC-MS/MS Analysis result of ab226277 could indicate that this peptide derived from Yeast-expressed Mycobacterium tuberculosis MPT64.

References

ab226277 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab226277.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up