Recombinant Mycobacterium tuberculosis MPT64 protein (His tag) (ab235017)

Overview

Description

  • Nature

    Recombinant
  • Source

    Baculovirus
  • Amino Acid Sequence
    • Accession
    • Species

      Mycobacterium tuberculosis
    • Sequence

      APKTYCEELKGTDTGQACQIQMSDPAYNINISLPSYYPDQKSLENYIAQT RDKFLSAATSSTPREAPYELNITSATYQSAIPPRGTQAVVLKVYQNAGGT HPTTTYKAFDWDQAYRKPITYDTLWQADTDPLPVVFPIVQGELSKQTGQQ VSIAPNAGLDPVNYQNFAVTNDGVIFFFNPGELLPEAAGPTQVLVPRSAI DSMLA
    • Molecular weight

      25 kDa including tags
    • Amino acids

      24 to 228
    • Tags

      His tag N-Terminus
    • Additional sequence information

      (Strain CDC 1551 / Oshkosh). Full length mature chain without signal peptide. 10xHis-tagged.

Specifications

Our Abpromise guarantee covers the use of ab235017 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Purity

    > 85 % SDS-PAGE.

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    Constituents: 50% Glycerol, Tris buffer

General Info

  • Alternative names

    • Antigen MPT64
    • immunogenic protein
    • immunogenic protein Mpt64
    • mpb64
    • MT2032
    • MTCY39.39
    • Rv1980c
    • simliar to Rv1980c of M. tuberculosis H37Rv
    see all
  • Cellular localization

    Secreted

Images

  • ab235017 analyzed by (Tris-Glycine gel) discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

References

ab235017 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab235017.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up