Recombinant Mycobacterium tuberculosis Mycobacterium tuberculosis Ag85B protein (His tag) (ab73632)

Overview

Description

  • Nature

    Recombinant
  • Source

    Escherichia coli
  • Amino Acid Sequence
    • Species

      Mycobacterium tuberculosis
    • Sequence

      MRGSHHHHHHFSRPGLPVEYLQVPSPSMGRDIKVQFQSGGNNSPAVYLLD GLRAQDDYNGWDINTPAFEWYYQSGLSIVMPVGGQSSFYSDWYSPACGKA GCQTYKWETFLTSELPQWLSANRAVKPTGSAAIGLSMAGSSAMILAAYHP QQFIYAGSLSALLDPSQGMGPSLIGLAMGDAGGYKAADMWGPSSDPAWER NDPTQQIPKLVANNTRLWVYCGNGTPNELGGANIPAEFLENFVRSSNLKF QDAYNAAGGHNAVFNFPPNGTHSWEYWGAQLNAMKGDLQSSLGAG
    • Molecular weight

      32 kDa including tags
    • Tags

      His tag N-Terminus
    • Additional sequence information

      Ag85B Recombinant His-Tag fusion protein produced in E.Coli is a single, non-glycosylated polypeptide chain having a molecular mass of 30kDa.

Associated products

Specifications

Our Abpromise guarantee covers the use of ab73632 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Purity

    > 90 % SDS-PAGE.
    Purity:Greater than 90.0% as determined by: (a) Analysis by RP-HPLC. (b) Analysis by SDS-PAGE.
  • Form

    Lyophilised
  • Additional notes

    For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).

    Sterile Filtered and lyophilized, though might appear as a solution as a result of the glycerol content.

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.

    Preservative: None
    No additives

  • Reconstitution
    Reconstitute in sterile 18MOhm/cm water at not less than 100µg/ml, which can then be further diluted to other aqueous solutions.

General Info

  • Alternative names

    • 30 kDa extracellular protein
    • Antigen 85 complex B
    • Mycobacterium
    • Mycolyl transferase 85B
  • Relevance

    Antigen 85B is the most abundant protein expressed by Mycobacterium tuberculosis (about one quarter). It is a myocolyc transferase in the myc pathway and catalyses - like Ag85A and Ag85C - the transfer of the fatty acid mycolate from one trehalose monomycolate to another, resulting in trehalose dimycolate and free trehalose and helping build the cell wall.

References

ab73632 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

Answer

Thank you for your inquiry.
Please find below the answers to your questions:

1.
I am happy to confirm that this protein (ab124604)is Antigen 85 sub unit A.

2.
a) ab73632 is the full length protein (aa 1 to 325)
b) I can confirm that ab833471 is also un-glycosylated because it was produced in E. coli which is missing the glycosylation machinery of eukaryotic cells.

I hope this information is helpful. Please do not hesitate to contact me again with any further questions.

Read More

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up