Description

  • Product name

    Recombinant ND-1 (human)
    See all MT-ND1 proteins and peptides
  • Purity

    40 % SDS-PAGE.

  • Expression system

    HEK 293 cells
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MPMANLLLLIVPILIAMAFLMLTERKILGYMQLRKGPNVVGPYGLLQPFA DAMKLFTKEPLKPATSTITLYITAPTLALTIALLLWTPLPMPNPLVNLNL GLLFILATSSLAVYSILWSGWASNSNYALIGALRAVAQTISYEVTLAIIL LSTLLMSGSFNLSTLITTQEHLWLLLPSWPLAMMWFISTLAETNRTPFDL AEGESELVSGFNIEYAAGPFALFFMAEYTNIIMMNTLTTTIFLGTTYDAL SPELYTTYFVTKTLLLTSLFLWIRTAYPRFRYDQLMHLLWKNFLPLTLAL LMWYVSMPITISSIPPQT
    • Predicted molecular weight

      61 kDa including tags
    • Amino acids

      1 to 318
    • Additional sequence information

      Rabbit Fc tag.

Associated products

Specifications

Our Abpromise guarantee covers the use of ab203842 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Store at -80°C.

    Constituents: 0.29% Sodium chloride, 0.03% EDTA, 0.14% Sodium phosphate, 0.59% Sodium citrate, 99% PBS

General Info

  • Alternative names

    • Complex I, subunit ND1
    • Mitochondrially encoded NADH dehydrogenase 1
    • MT-ND1
    • MTND1
    • NAD1
    • NADH dehydrogenase subunit 1
    • NADH dehydrogenase subunit 1 (complex I)
    • NADH-ubiquinone oxidoreductase chain 1
    • NADH-ubiquinone oxidoreductase, subunit ND1
    • NADH1
    • ND1
    • NU1M_HUMAN
    see all
  • Function

    Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone.
  • Involvement in disease

    Defects in MT-ND1 are a cause of Leber hereditary optic neuropathy (LHON) [MIM:535000]. LHON is a maternally inherited disease resulting in acute or subacute loss of central vision, due to optic nerve dysfunction. Cardiac conduction defects and neurological defects have also been described in some patients. LHON results from primary mitochondrial DNA mutations affecting the respiratory chain complexes.
    Defects in MT-ND1 are a cause of mitochondrial encephalomyopathy with lactic acidosis and stroke-like episodes syndrome (MELAS) [MIM:540000]. MELAS is a genetically heterogenious disorder, characterized by episodic vomiting, seizures, and recurrent cerebral insults resembling strokes and causing hemiparesis, hemianopsia, or cortical blindness.
    Defects in MT-ND1 may be associated with susceptibility to Alzheimer disease mitochondrial (AD-MT) [MIM:502500]. Alzheimer disease is a neurodegenerative disorder characterized by progressive dementia, loss of cognitive abilities, and deposition of fibrillar amyloid proteins as intraneuronal neurofibrillary tangles, extracellular amyloid plaques and vascular amyloid deposits. The major constituent of these plaques is the neurotoxic amyloid-beta-APP 40-42 peptide (s), derived proteolytically from the transmembrane precursor protein APP by sequential secretase processing. The cytotoxic C-terminal fragments (CTFs) and the caspase-cleaved products such as C31 derived from APP, are also implicated in neuronal death.
    Defects in MT-ND1 may be associated with non-insulin-dependent diabetes mellitus (NIDDM).
  • Sequence similarities

    Belongs to the complex I subunit 1 family.
  • Cellular localization

    Mitochondrion inner membrane.
  • Information by UniProt

Images

  • 500 ng of recombinant Human MT-ND1 protein was ran on a MOPS-based SDS-PAGE gel, and stained with silver-stain.

References

ab203842 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab203842.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up