Overview

Description

  • Nature

    Recombinant
  • Source

    HEK 293 cells
  • Amino Acid Sequence
    • Accession
    • Sequence

      QKLDDVDPLVATNFGKIRGIKKELNNEILGPVIQFLGVPYAAPPTGERRF QPPEPPSPWS DIRNATQFAPVCPQNIIDGRLPEVMLPVWFTNNLDVVS SYVQDQSEDCLYLNIYVPTEDG PLTKKRDEATLNPPDTDIRDSGGPKP VMVYIHGGSYMEGTGNLYDGSVLASYGNVIVITV NYRLGVLGFLSTGD QAAKGNYGLLDLIQALRWTSENIGFFGGDPLRITVFGSGAGGSCVN LL TLSHYSEGNRWSNSTKGLFQRAIAQSGTALSSWAVSFQPAKYARMLATKV GCNVSDTV ELVECLQKKPYKELVDQDIQPARYHIAFGPVIDGDVIPDD PQILMEQGEFLNYDIMLGVN QGEGLKFVENIVDSDDGISASDFDFAVS NFVDNLYGYPEGKDVLRETIKFMYTDWADRHN PETRRKTLLALFTDHQ WVAPAVATADLHSNFGSPTYFYAFYHHCQTDQVPAWADAAHGDE VPYV LGIPMIGPTELFPCNFSKNDVMLSAVVMTYWTNFAKTGDPNQPVPQDTKF IHTKPN RFEEVAWTRYSQKDQLYLHIGLKPRVKEHYRANKVNLWLELV PHLHNLNDISQYTSTTTK VPSTDITFRPTRKNSVPVTSAFPTAKQDDP KQQPSPFSVDQRDYSTELS
    • Molecular weight

      72 kDa
    • Amino acids

      46 to 694
    • Tags

      His tag C-Terminus

Specifications

Our Abpromise guarantee covers the use of ab151648 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    HPLC

  • Endotoxin level

    < 1.000 Eu/µg
  • Purity

    > 95 % SDS-PAGE.
    ab151648 was determined to be >95% pure by SEC-HPLC and reducing SDS-PAGE.
  • Form

    Lyophilised
  • Additional notes

    ab151648 was produced by a mammalian cell expression system in HEK293.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. After reconstitution store at -20ºC. Avoid freeze / thaw cycles.

    pH: 7.20
    Constituents: 99% Phosphate Buffer, 0.88% Sodium chloride

  • Reconstitution
    Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Dissolve the lyophilized protein in 1X PBS.

General Info

  • Alternative names

    • NLG 1
    • KIAA1070
    • MGC45115
    • Neuroligin-1
    • NL1
    • NLG1
    • Nlgn1
    • NLGN1_HUMAN
    see all
  • Function

    Neuronal cell surface protein thought to be involved in cell-cell-interactions by forming intercellular junctions through binding to beta-neurexins. Seems to play role in formation or maintenance of synaptic junctions. In vitro, triggers the de novo formation of presynaptic structures. May be involved in specification of excitatory synapses.
  • Tissue specificity

    Expressed in the blood vessel walls (at protein level).
  • Sequence similarities

    Belongs to the type-B carboxylesterase/lipase family.
  • Cellular localization

    Cell membrane. Cell junction > synapse. Cell junction > synapse > postsynaptic cell membrane > postsynaptic density. Enriched in synaptic plasma membranes and clustered in synaptic clefts and postsynaptic densities.
  • Information by UniProt

References

ab151648 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab151648.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up