Recombinant OmpA protein (Tagged) (ab225985)

Overview

Description

  • Nature

    Recombinant
  • Source

    Mammalian
  • Amino Acid Sequence
    • Accession
    • Species

      Salmonella enterica
    • Sequence

      DVQEAKLRDKMRGTGVSVTRSGDNIILNMPNNVTFDSSSATLKPAGANTL TGVAMVLKEYPKTAVNVVGYTDSTGSHDLNMRLSQQRADSVASSLITQGV DASRIRTSGMGPANPIASNSTAEGKAQNRRVEITLSPLQ
    • Molecular weight

      19 kDa including tags
    • Amino acids

      82 to 220
    • Tags

      His tag N-Terminus
    • Additional sequence information

      N-terminal 10xHis tag and C-terminal Myc tag. Salmonella enterica subsp. enterica serovar Enteritidis str. 2009K0958

Specifications

Our Abpromise guarantee covers the use of ab225985 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Purity

    > 90 % SDS-PAGE.

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    Constituents: 50% Glycerol, Tris buffer

General Info

  • Alternative names

    • Outer membrane protein P5
  • Relevance

    Function Acts as a fimbriae subunit.

Images

  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

References

ab225985 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab225985.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up