Recombinant OmpA protein (Tagged) (ab226269)

Description

  • Product name

    Recombinant OmpA protein (Tagged)
    See all OmpA proteins and peptides
  • Purity

    > 90 % SDS-PAGE.

  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Haemophilus influenzae
    • Sequence

      APQENTFYAGVKAGQGSFHDGINNNGAIKKGLSSSNYGYRRNTFTYGVFG GYQILNQDNFGLAAELGYDDFGRAKLREAGKPKAKHTNHGAYLSLKGSYE VLDGLDVYGKAGVALVRSDYKFYEDANGTRDHKKGRHTARASGLFAVGAE YAVLPELAVRLEYQWLTRVGKYRPQDKPNTAINYNPWIGCINAGISYRFG QGEAPVVAAPEMVSKTFSLNSDVTFAFGKANLKPQAQATLDSVYGEISQV KSRKVAVAGYTNRIGSDAFNVKLSQERADSVANYFVAKGVAADAISATGY GEANPVTGATCDQVKGRKALIACLAPDRRVEIAVNGTK
    • Predicted molecular weight

      56 kDa including tags
    • Amino acids

      22 to 359
    • Tags

      His tag N-Terminus
    • Additional sequence information

      Haemophilus influenzae. This product is the mature full length protein from aa 22 to 359 with a 10xHis-SUMO tag at the N-terminus and a Myc tag at the C-terminus. The signal peptide is not included.

Specifications

Our Abpromise guarantee covers the use of ab226269 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Mass Spectrometry

    SDS-PAGE

  • Mass spectrometry

    LC-MS/MS
  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    Constituents: 50% Glycerol, Tris buffer

General Info

  • Alternative names

    • Outer membrane protein P5
  • Relevance

    Function Acts as a fimbriae subunit.

Images

  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) analysis of ab226269 with 5% enrichment gel and 15% separation gel.

  • Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS analysis result of ab226269 could indicate that this peptide derived from E.coli-expressed Haemophilus influenzae ompA.

  • Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS analysis result of ab226269 could indicate that this peptide derived from E.coli-expressed Haemophilus influenzae ompA.

References

ab226269 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab226269.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up