Recombinant P. falciparum HSP90 protein (ab222790)

Description

  • Product name

    Recombinant P. falciparum HSP90 protein
  • Purity

    > 90 % SDS-PAGE.
    Affinity purified.
  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Plasmodium falciparum
    • Sequence

      QPVLEINPNHFIIKQLNHLIQIDKMNLQNSEIAEQIFDVASMQGGYTIDD TGLFAKRVIGMMEKNAEQYLMNVQSNISNNTLNNNTSGSEMPQNNSPNEL QSEMKSTNGIDDNSNISENKINESSSNQNNIGENSIAEENNIKNIAESDV NKINLGENDVSQNTMHKQDSGLFNLDPSILNSNMLSGSDKTLL
    • Predicted molecular weight

      21 kDa
    • Amino acids

      735 to 927
    • Additional sequence information

      XP_001348591.1.

Specifications

Our Abpromise guarantee covers the use of ab222790 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -20°C long term. Avoid freeze / thaw cycle.

    pH: 7.50
    Constituents: 10% Glycerol, 1.74% Sodium chloride, 0.79% Tris HCl

References

ab222790 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab222790.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up