Overview

  • Product name

    Recombinant Papain protein (His tag)
  • Protein length

    Full length protein

Description

  • Nature

    Recombinant
  • Source

    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species

      Papaya
    • Sequence

      IPEYVDWRQKGAVTPVKNQGSCGSCWAFSAVVTIEGIIKIRTGNLNEYSE QELLDCDRRSYGCNGGYPWSALQLVAQYGIHYRNTYPYEGVQRYCRSREK GPYAAKTDGVRQVQPYNEGALLYSIANQPVSVVLEAAGKDFQLYRGGIFV GPCGNKVDHAVAAVGYGPNYILIKNSWGTGWGENGYIRIKRGTGNSYGVC GLYTSSFYPVKN
    • Molecular weight

      27 kDa including tags
    • Amino acids

      134 to 345
    • Tags

      His tag N-Terminus
    • Additional sequence information

      This product is the mature full length protein from aa 134 to 345. The signal peptide and propeptide are not included.

Specifications

Our Abpromise guarantee covers the use of ab225601 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Purity

    > 90 % SDS-PAGE.

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    Constituents: 50% Glycerol, Tris buffer

General Info

  • Alternative names

    • Allergen Car p 1
    • Car p 1
    • Papain
    • Papaya proteinase I
    • PPI
    see all
  • Relevance

    Papain is a protease derived from the papaya fruit (Carica papaya). It hydrolyses peptides with broad specificity, but shows a preference for large hydrophobic amino acids in the P2 position. It is synthesised as an inactive 40 kDa precursor containing a 107 residue N terminal pro region and a 26 residue signal peptide.

Images

  • Discontinuous SDS-PAGE (Tris-Glycine gel) (reduced) analysis of ab225601 with 5% enrichment gel and 15% separation gel.

References

ab225601 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab225601.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up