Recombinant Pectate lyase 1 protein (Tagged) (ab239542)

Description

  • Product name

    Recombinant Pectate lyase 1 protein (Tagged)
  • Purity

    > 90 % SDS-PAGE.

  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Sequence

      DNPIDSCWRGDSNWDQNRMKLADCVVGFGSSTMGGKGGEIYTVTSSEDNP VNPTPGTLRYGATREKALWIIFSQNMNIKLQMPLYVAGYKTIDGRGADVH LGNGGPCLFMRKASHVILHGLHIHGCNTSVLGDVLVSESIGVEPVHAQDG DAITMRNVTNAWIDHNSLSDCSDGLIDVTLGSTGITISNNHFFNHHKVML LGHDDTYDDDKSMKVTVAFNQFGPNAGQRMPRARYGLVHVANNNYDQWNI YAIGGSSNPTILSEGNSFTAPNESYKKEVTKRIGCETTSACANWVWRSTR DAFTNGAYFVSSGKAEDTNIYNSNEAFKVENGNAAPQLTQNAGVVA
    • Predicted molecular weight

      43 kDa including tags
    • Amino acids

      22 to 367
    • Tags

      His tag N-Terminus
    • Additional sequence information

      Hesperocyparis arizonica (Arizona cypress) (Cupressus arizonica). This product is the mature full length protein. The signal peptide is not included. N-terminal 10xHis-tag and C-terminal Myc-tag.

Specifications

Our Abpromise guarantee covers the use of ab239542 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Mass Spectrometry

    SDS-PAGE

  • Mass spectrometry

    LC-MS/MS
  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    Constituents: Tris buffer, 50% Glycerol

Images

  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) analysis with 5% enrichment gel and 15% separation gel of ab239542.

  • Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of ab239542 could indicate that this peptide derived from E.coli-expressed Cupressus arizonica (Arizona cypress) (Callitropsis arizonica) Pectate lyase 1.

  • Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of ab239542 could indicate that this peptide derived from E.coli-expressed Cupressus arizonica (Arizona cypress) (Callitropsis arizonica) Pectate lyase 1.

References

ab239542 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab239542.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up