Recombinant Penicillin-binding protein 1A (His tag) (ab225616)

Description

  • Product name

    Recombinant Penicillin-binding protein 1A (His tag)
    See all Penicillin-binding protein 1A proteins and peptides
  • Purity

    > 90 % SDS-PAGE.

  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Sequence

      VDRISGKLPTQLSYRDPRGSTVYNEFFINGTIPTEYDDIHVEAQINKLTG KLASKFTPSFLVESRVFLRRDYSPGVELLDQQWLLPYSIDEGGSLPPTEE KNNSNTRDKNKDKNKNKNKDKNPSQDKPNNNNNDNNSNNNNNNNDNNNNT KPPENDSNQNHEDNKNKQ
    • Predicted molecular weight

      35 kDa including tags
    • Amino acids

      663 to 830
    • Tags

      His tag N-Terminus
    • Additional sequence information

      Clostridium botulinum (strain Hall / ATCC 3502 / NCTC 13319 / Type A) protein with 6xHis-SUMO tag at the N-terminus.

Specifications

Our Abpromise guarantee covers the use of ab225616 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    Constituents: 50% Glycerol, Tris buffer

General Info

  • Alternative names

    • mrcA
    • PBP 1a
    • PBP1a
    • pbpA
  • Cellular localization

    Cell inner membrane

Images

  • ab225616 analyzed by SDS-PAGE (Tris-Glycine gel with 5% enrichment gel and 15% separation gel).

References

ab225616 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab225616.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up