Description

  • Product name

    Recombinant Phosphinotricin Acetyl Transferase protein (His tag)
  • Purity

    > 90 % SDS-PAGE.

  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Streptomyces hygroscopicus
    • Sequence

      MSPERRPADIRRATEADMPAVCTIVNHYIETSTVNFRTEPQEPQEWTDDL VRLRERYPWLVAEVDGEVAGIAYAGPWKARNAYDWTAESTVYVSPRHQRT GLGSTLYTHLLKSLEAQGFKSVVAVIGLPNDPSVRMHEALGYAPRGMLRA AGFKHGNWHDVGFWQLDFSLPVPPRPVLPVTEI
    • Predicted molecular weight

      25 kDa including tags
    • Amino acids

      1 to 183
    • Tags

      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab224834 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    Constituents: 50% Glycerol, Tris buffer

General Info

  • Alternative names

    • PAT
    • Phosphinothricin resistance protein
    • PPT N acetyltransferase
  • Relevance

    The most commonly used selection markers in plant transformation are the bacterial bar gene encoding for the phosphinotricin acetyl transferase (PAT) and the gene encoding for neomycin phosphotransferase II (NPTII). The bar/pat gene was isolated from Streptomyces hygroscopicus. It encodes a small (21 kDa) protein. The pat gene confers resistance to the glufosinate ammonium herbicides bialaphos (BASTA), and phosphinotricin (PPT). PAT belongs to the family of acetyltransferases. It acetylates and inactivates the herbicides bialaphos and PPT. PAT can be used to detect relative transfection efficiencies in cells where multiple transfections are performed in parallel with different plasmids. PAT has been used routinely as a resistance gene in the production of genetically engineered crops and for the production of herbicide resistant crops. The PAT gene is an approved food additive for use as a processing aid in the development of new varieties of crops, including wheat, corn, and rice.

References

ab224834 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab224834.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up