Recombinant Pig beta 2 Microglobulin + FCGRT/FCRN protein (Tagged-His Tag) (ab219708)

Description

  • Product name

    Recombinant Pig beta 2 Microglobulin + FCGRT/FCRN protein (Tagged-His Tag)
  • Purity

    > 95 % SDS-PAGE.

  • Endotoxin level

    < 1.000 Eu/µg
  • Expression system

    HEK 293 cells
  • Accession

  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Amino Acid Sequence 1

    • Species

      Pig
    • Sequence

      DNHRSLLYHLTAVSAPTPGAPAFWVSGWLGPQQYLSYNNLRAQAEPYGAW VWESQVSWYWEKETADLRNKQKLFLEALKTLEEGGPFTLQGLLGCELGPD NVSVPVATFALNGEEFMKFDTKLGTWDGEWPEARTIGSKWMQEPDAVDKE KTFLLYSCPHRLLGHLERGRGNLEWKEPPSMRMKARPGTAPGFSVLTCIA FSFYPPELQLRFLRNGLAAGSGESDIGPNGDGSFHAWSSLTVKSGDEHHY CCVVQHAGLAQPLTVELESPAKSS
    • Predicted molecular weight

      32 kDa including tags
    • Amino acids

      16 to 289
    • Tags

      His tag C-Terminus
    • Additional sequence information

      FCGRT.
    • Amino Acid Sequence 2

    • Species

      Pig
    • Sequence

      VARPPKVQVYSRHPAENGKPNYLNCYVSGFHPPQIEIDLLKNGEKMNAEQ SDLSFSKDWSFYLLVHTEFTPNAVDQYSCRVKHVTLDKPKIVKWDRDH
    • Predicted molecular weight

      13 kDa including tags
    • Amino acids

      21 to 118
    • Tags

      StrepII tag C-Terminus
    • Additional sequence information

      This product is the mature full length B2M protein from aa21 - 119. The signal peptide is not included.

Specifications

Our Abpromise guarantee covers the use of ab219708 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 7.40
    Constituents: 5% Trehalose, 95% PBS

    Note: 5-10% trehalose is commonly used for freeze drying, and after reconstitution, the trehalose is mostly about 3-5%. Lyophilised from 0.22 µm filtered solution.

  • Reconstitution
    It is recommended to reconstitute the lyophilised product in sterile deionized water to a final concentration of 1 mg/ml. Solubilize for 30 to 60 minutes at room temperature with occasional gentle mixing. Carrier protein (0.1% HSA or BSA) is strongly recommended for further dilution and long term storage.

General Info

  • Cellular localization

    beta 2 Microglobulin: Secreted. Detected in serum and urine. FCGRT: Cell membrane.

Images

  • SDS-PAGE analysis of ab219708 stained overnight with Coomassie Blue.

    The protein migrates as 36 kDa (FCGRT), 15 kDa (B2M) respectively on a SDS-PAGE gel under reducing conditions.

References

ab219708 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab219708.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up