Description

  • Product name

    Recombinant Pig CCL25 protein
    See all CCL25 proteins and peptides
  • Purity

    > 95 % SDS-PAGE.
    ab208817 was purified by Ion-exchange chromatography.
  • Expression system

    Yeast
  • Accession

  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Pig
    • Sequence

      QGAFEDCCLAYHSHIKWRLLRRAHSYQRQDVSGSCNLPAVIFFFPQKDKM VC
    • Predicted molecular weight

      6 kDa
    • Amino acids

      24 to 75

Specifications

Our Abpromise guarantee covers the use of ab208817 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Lyophilised
  • Additional notes

    ab208817 was produced in yeast and therefore does not have endotoxin, is naturally folded, and post-translationally modified.

     This product was previously labelled as TECK

     

     This product was previously labelled as TECK

     

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot. Store at -20°C. Avoid freeze / thaw cycle.

    Constituents: 90% PBS, 10% Trehalose

  • Reconstitution
    Reconstitute with sterile phosphate-buffered saline containing at least 0.1% carrier protein.

General Info

  • Alternative names

    • A130072A22Rik
    • C-C motif chemokine 25
    • CCL 25
    • CCL25
    • CCL25_HUMAN
    • Chemokine (C C motif) ligand 25
    • Chemokine (CC motif) ligand 25
    • Chemokine C C motif ligand 25
    • Chemokine CC motif ligand 25
    • Chemokine TECK
    • Ck beta 15
    • Ckb 15
    • Ckb15
    • MGC125074
    • MGC150327
    • SCY A25
    • SCYA 25
    • SCYA25
    • Small inducible cytokine A25
    • Small inducible cytokine A25 isoform 1 precursor
    • Small inducible cytokine A25 isoform 2 precursor
    • Small inducible cytokine subfamily A (Cys Cys) member 25
    • Small inducible cytokine subfamily A Cys Cys member 25
    • Small inducible cytokine subfamily A, member 25
    • Small-inducible cytokine A25
    • TECK
    • TECKvar
    • Thymus expressed chemokine
    • Thymus-expressed chemokine
    see all
  • Function

    Potentially involved in T-cell development. Recombinant protein shows chemotactic activity on thymocytes, macrophages, THP-1 cells, and dendritics cells but is inactive on peripheral blood lymphocytes and neutrophils. Binds to CCR9. Isoform 2 is an antagonist of isoform 1.
  • Tissue specificity

    Specifically expressed by thymic dendritic cells. High levels in thymus and small intestine.
  • Sequence similarities

    Belongs to the intercrine beta (chemokine CC) family.
  • Cellular localization

    Secreted.
  • Information by UniProt

References

ab208817 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab208817.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up