Description

  • Product name

    Recombinant Pig CXCL9 protein
    See all CXCL9 proteins and peptides
  • Purity

    > 95 % SDS-PAGE.
    ab209127 was purified by Ion-exchange chromatography.
  • Expression system

    Yeast
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Pig
    • Sequence

      TLLMRNGRCSCINTSQRMIHLKSLRDLKQFAPSPSCEKMEVIATMKNGDQ TCLNPDSPDVKKLIKEWEKQVSLKKKQKKGKKHPKTKKVRKVKKSQRPDQ KKMT
    • Predicted molecular weight

      12 kDa
    • Amino acids

      23 to 126
    • Additional sequence information

      This product is the mature full length protein from aa 23 to 126. The signal peptide is not included. Entrez gene: 100135681.

Specifications

Our Abpromise guarantee covers the use of ab209127 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Lyophilised
  • Additional notes

    ab209127 was produced in yeast and therefore does not have endotoxin, is naturally folded, and post-translationally modified. It can be used in cell culture, as a MIG ELISA Standard, and as a Western Blot Control.

    Stable for up to twelve months from date of receipt at -20°C. Stable for at least 3 months when stored in working aliquots with a carrier protein at -20°C. Avoid repeated freeze/thaw cycle.

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -20°C. Avoid freeze / thaw cycle.

    Constituents: 90% PBS, 10% Trehalose

  • Reconstitution
    Reconstitute with sterile phosphate-buffered saline containing at least 0.1% carrier protein.

General Info

  • Alternative names

    • C-X-C motif chemokine 9
    • chemokine (C-X-C motif) ligand 9
    • CMK
    • crg-10
    • CXCL9
    • CXCL9_HUMAN
    • gamma interferon induced monokine
    • Gamma-interferon-induced monokine
    • HuMIG
    • MIG
    • monokine induced by gamma interferon
    • monokine induced by interferon gamma
    • Monokine induced by interferon-gamma
    • SCYB9
    • Small inducible cytokine B9
    • small inducible cytokine subfamily B member 9
    • Small-inducible cytokine B9
    see all
  • Function

    Cytokine that affects the growth, movement, or activation state of cells that participate in immune and inflammatory response. Chemotactic for activated T-cells. Binds to CXCR3.
  • Sequence similarities

    Belongs to the intercrine alpha (chemokine CxC) family.
  • Cellular localization

    Secreted.
  • Information by UniProt

References

ab209127 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab209127.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up