Bioactive grade

Recombinant pig Flt3 ligand/Flt3L protein (ab233680)

Description

  • Product name

    Recombinant pig Flt3 ligand/Flt3L protein
    See all Flt3 ligand/Flt3L proteins and peptides
  • Biological activity

    OCI-AML5 cell proliferation. ED50 ≤ 5 ng/mL (≥ 2.0 x 105 units/mg).

  • Purity

    > 95 % SDS-PAGE.

  • Endotoxin level

    <=1.000 Eu/µg
  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Protein fragment
  • Animal free

    Yes
  • Nature

    Recombinant
    • Species

      Pig
    • Sequence

      MSPDCSFPHSPISSTFANTIRQLSDYLLQDYPVTVASNLQDDELCGAFWR LVLAQRWMGQLKTVAGSQMQKLLEAVNTEIVFVTSCALQPLPSCLRFVQA NISHLLQDTSQQLVALKPWITRRNFSRCLELQCQPDPSTLLPPRSPGALE ATSLP
    • Predicted molecular weight

      17 kDa
    • Amino acids

      30 to 183

Specifications

Our Abpromise guarantee covers the use of ab233680 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Functional Studies

    SDS-PAGE

  • Form

    Lyophilised
  • Additional notes

    Previously labelled as Flt3 ligand.

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at Room Temperature. Store at -20°C long term.

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

  • Reconstitution
    Sterile water at 0.1 mg/mL. Centrifuge vial before opening. Suspend the product by gently pipetting the above recommended solution down the sides of the vial. DO NOT VORTEX. Allow several minutes for complete reconstitution. For prolonged storage, dilute to working aliquots in a 0.1% BSA solution, store at -80°C and avoid repeat freeze thaws.

General Info

  • Alternative names

    • FL
    • Flt 3 ligand
    • Flt 3L
    • Flt3 L
    • FLT3 LG
    • Flt3 ligand
    • Flt3L
    • FLT3L_HUMAN
    • Flt3lg
    • Fms related tyrosine kinase 3 ligand
    • Fms-related tyrosine kinase 3 ligand
    • SL cytokine
    see all
  • Function

    Stimulates the proliferation of early hematopoietic cells by activating FLT3. Synergizes well with a number of other colony stimulating factors and interleukins.
  • Cellular localization

    Secreted and Cell membrane.
  • Information by UniProt

Images

  • SDS-PAGE - Recombinant Flt3 ligand/Flt3L (Active) (ab233680) at 1 µg.

    Lane 1: Non-reducing conditions.

    Lane 2: Reducing conditions.

    4-20% Tris-Glycine gel stained with Coomassie Blue.

  • Pig Flt3 ligand/Flt3L (ab233680) induced proliferation of OCI-AML5 cells.

References

ab233680 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab233680.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up