Bioactive grade

Recombinant pig Flt3 ligand/Flt3L protein (Active) (ab233607)

Description

  • Product name

    Recombinant pig Flt3 ligand/Flt3L protein (Active)
    See all Flt3 ligand/Flt3L proteins and peptides
  • Biological activity

    OCI-AML5 cell proliferation. ED50 ≤ 5 ng/mL (≥ 2.0 x 105 units/mg).

  • Purity

    >= 95 % SDS-PAGE.

  • Endotoxin level

    <=1.000 Eu/µg
  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Pig
    • Sequence

      MSPDCSFPHSPISSTFANTIRQLSDYLLQDYPVTVASNLQDDELCGAFWR LVLAQRWMGQLKTVAGSQMQKLLEAVNTEIVFVTSCALQPLPSCLRFVQA NISHLLQDTSQQLVALKPWITRRNFSRCLELQCQPDPSTLLPPRSPGALE ATSLP
    • Predicted molecular weight

      17 kDa
    • Amino acids

      30 to 183

Specifications

Our Abpromise guarantee covers the use of ab233607 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Functional Studies

  • Form

    Lyophilised
  • Additional notes

    Previously labelled as Flt3 ligand.

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -20°C. Avoid freeze / thaw cycle.

    pH: 7.50
    Constituent: 0.16% Sodium phosphate

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

  • Reconstitution
    Centrifuge vial before opening. Reconstitute with sterile water at 0.1 mg/ml. Suspend the product by gently pipetting the above recommended solution down the sides of the vial. DO NOT VORTEX. Allow several minutes for complete reconstitution. For prolonged storage, dilute to working aliquots in a 0.1% BSA solution, store at -80°C and avoid repeat freeze thaws.

General Info

  • Alternative names

    • FL
    • Flt 3 ligand
    • Flt 3L
    • Flt3 L
    • FLT3 LG
    • Flt3 ligand
    • Flt3L
    • FLT3L_HUMAN
    • Flt3lg
    • Fms related tyrosine kinase 3 ligand
    • Fms-related tyrosine kinase 3 ligand
    • SL cytokine
    see all
  • Function

    Stimulates the proliferation of early hematopoietic cells by activating FLT3. Synergizes well with a number of other colony stimulating factors and interleukins.
  • Cellular localization

    Secreted and Cell membrane.
  • Information by UniProt

Images

  • 1 µg ab233607 analyzed on a 4-20% Tris-Glycine gel, stained with Coomassie Blue.

    Lane 1: Non-reducing conditions.

    Lane 2: Reducing conditions.

  • ab233607 induced proliferation of OCI-AML5 cells.

References

ab233607 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab233607.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up