Description

  • Product name

    Recombinant Pig Growth hormone receptor protein (His tag)
    See all Growth hormone receptor proteins and peptides
  • Purity

    > 85 % SDS-PAGE.

  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Pig
    • Sequence

      FSGSEATPAVLVRASQSLQRVHPGLETNSSGKPKFTKCRSPELETFSCHW TDGVRHGLQSPGSIQLFYIRRSTQEWTQEWKECPDYVSAGENSCYFNSSY TSIWIPYCIKLTSNGGTVDQKCFSVEEIVQPDPPIGLNWTLLNISLTGIH ADIQVRWEPPPNADVQKGWIVLEYELQYKEVNETQWKMMDPVLSTSVPVY SLRLDKEYEVRVRSRQRNSEKYGEFSEVLYVTLPQMSPFACEEDFR
    • Predicted molecular weight

      30 kDa including tags
    • Amino acids

      19 to 264
    • Tags

      His tag C-Terminus
    • Additional sequence information

      Extracellular domain. C-terminal 6xHis-tagged.

Specifications

Our Abpromise guarantee covers the use of ab235713 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    Constituents: Tris buffer, 50% Glycerol

General Info

  • Alternative names

    • GH receptor
    • GH-binding protein
    • GHBP
    • GHBP, included
    • GHR
    • GHR_HUMAN
    • Growth hormone binding protein
    • Growth hormone receptor
    • Growth hormone receptor precursor
    • Growth hormone-binding protein
    • Growth hormone-binding protein, included
    • Increased responsiveness to growth hormone, included
    • Serum binding protein
    • Serum-binding protein
    • Somatotropin receptor
    see all
  • Function

    Receptor for pituitary gland growth hormone involved in regulating postnatal body growth. On ligand binding, couples to the JAK2/STAT5 pathway.
    The soluble form (GHBP) acts as a reservoir of growth hormone in plasma and may be a modulator/inhibitor of GH signaling.
    Isoform 2 up-regulates the production of GHBP and acts as a negative inhibitor of GH signaling.
  • Tissue specificity

    Expressed in various tissues with high expression in liver and skeletal muscle. Isoform 4 is predominantly expressed in kidney, bladder, adrenal gland and brain stem. Isoform 1 expression in placenta is predominant in chorion and decidua. Isoform 4 is highly expressed in placental villi. Isoform 2 is expressed in lung, stomach and muscle. Low levels in liver.
  • Involvement in disease

    Defects in GHR are a cause of Laron syndrome (LARS) [MIM:262500]. A severe form of growth hormone insensitivity characterized by growth impairment, short stature, dysfunctional growth hormone receptor, and failure to generate insulin-like growth factor I in response to growth hormone.
    Defects in GHR may be a cause of idiopathic short stature autosomal (ISSA) [MIM:604271]. Short stature is defined by a subnormal rate of growth.
  • Sequence similarities

    Belongs to the type I cytokine receptor family. Type 1 subfamily.
    Contains 1 fibronectin type-III domain.
  • Domain

    The WSXWS motif appears to be necessary for proper protein folding and thereby efficient intracellular transport and cell-surface receptor binding.
    The box 1 motif is required for JAK interaction and/or activation.
    The extracellular domain is the ligand-binding domain representing the growth hormone-binding protein (GHBP).
    The ubiquitination-dependent endocytosis motif (UbE) is required for recruitment of the ubiquitin conjugation system on to the receptor and for its internalization.
  • Post-translational
    modifications

    The soluble form (GHBP) is produced by phorbol ester-promoted proteolytic cleavage at the cell surface (shedding) by ADAM17/TACE. Shedding is inhibited by growth hormone (GH) binding to the receptor probably due to a conformational change in GHR rendering the receptor inaccessible to ADAM17.
    On GH binding, phosphorylated on tyrosine residues in the cytoplasmic domain by JAK2.
    On ligand binding, ubiquitinated on lysine residues in the cytoplasmic domain. This ubiquitination is not sufficient for GHR internalization.
  • Cellular localization

    Secreted; Cell membrane. On growth hormone binding, GHR is ubiquitinated, internalized, down-regulated and transported into a degradative or non-degradative pathway and Cell membrane. Remains fixed to the cell membrane and is not internalized.
  • Information by UniProt

Images

  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) analysis with 5% enrichment gel and 15% separation gel of ab235713.

References

ab235713 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab235713.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up