Recombinant Pig IFN omega 7 protein (ab209379)

Overview

  • Product name

    Recombinant Pig IFN omega 7 protein
  • Protein length

    Full length protein

Description

  • Nature

    Recombinant
  • Source

    Yeast
  • Amino Acid Sequence
    • Accession
    • Species

      Pig
    • Sequence

      GSLGCDLSQNHVHISRKNLVLLHQMRRISPSFCLKDRKDFGLPQEMVDGS HLQKAQAISVLHEMLQQTFLLFHIKRSSAAWDSILLDKLHSGLHQQLEDL DPCLVQEMGEQASALGMAMKKYFQGIHLYLKEKKYSDCAWEIVRVEIMRA LSFSTNLQERLRIMDEHLGSP
    • Molecular weight

      20 kDa
    • Amino acids

      20 to 190
    • Additional sequence information

      This product is for the mature full length protein. The signal peptide is not included.

Specifications

Our Abpromise guarantee covers the use of ab209379 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Purity

    > 95 % SDS-PAGE.
    ab209379 is purified by Ion Exchange Chromatography.
  • Form

    Lyophilised
  • Additional notes

    ab209379 was produced in yeast and therefore does not have endotoxin, is naturally folded, and post-translationally modified.

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot. Store at -20°C. Avoid freeze / thaw cycle.

    Constituents: 10% Trehalose, 90% PBS

  • Reconstitution
    Reconstitute with sterile phosphate-buffered saline containing at least 0.1% carrier protein.

References

ab209379 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab209379.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up