Description

  • Product name

    Recombinant Pig IL-12 protein
  • Expression system

    Yeast
  • Accession

  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Pig
    • Sequence

      IWELEKNVYVVELDWYPNAPGEMVVLTCNTPEEDGITWTSDQSSEVLGTG KTLTIHVKEFGDAGQYTCRKGGAVLSQSLLLLHKKEDGIWSTDILKDQKE PKNKSFLKCEAKNYSGRFTCWWLTAISTDLKFSVKSSRGSTDPRGVTCGT ATLSEDLGEYKKYRVECQEGSACPAAEESLPIEVVLEAVHKLKYENYTSS FFIRDIIKPDPPKNLQLNPLKNSRHVEISWEYPDTWSTPHSYFSLMFGVQ VQGKNKREKKDKLFTDQISAKVTCHKDANIRVQARDRYYSSSWSEWASVS CN
    • Predicted molecular weight

      34 kDa
    • Amino acids

      23 to 324
    • Additional sequence information

      Mature protein without signal peptide.

Specifications

Our Abpromise guarantee covers the use of ab209156 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Lyophilised
  • Additional notes

    ab209156 was produced in yeast and therefore does not have endotoxin, is naturally folded, and post-translationally modified.

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon reconsitution add a carrier protein (0.1% BSA). Store at -20°C long term. Avoid freeze / thaw cycle.

    Constituents: 10% Trehalose, 90% PBS

  • Reconstitution
    Reconstitute with sterile phosphate-buffered saline containing at least 0.1% carrier protein. Stable for up to twelve months from date of receipt at -20°C. Stable for at least 3 months when stored in working aliquots with a carrier protein at -20°C. Avoid repeated freeze/thaw cycle.

General Info

  • Alternative names

    • CLMF
    • CLMF p35
    • CLMF p40
    • CLMF2
    • Cytotoxic lymphocyte maturation factor 35 kDa subunit
    • Cytotoxic lymphocyte maturation factor 40 kDa subunit
    • IL 12 p40
    • IL 12A
    • IL 12B
    • IL-12 subunit p35
    • IL-12A
    • IL-12B
    • IL12
    • IL12 p35
    • IL12 p40
    • IL12 subunit p40
    • IL12A
    • IL12A_HUMAN
    • Interleukin 12 alpha chain
    • Interleukin 12 beta chain
    • Interleukin-12 subunit alpha
    • NK cell stimulatory factor chain 1
    • NK cell stimulatory factor chain 2
    • NKSF
    • NKSF1
    • NKSF2
    see all
  • Function

    Cytokine that can act as a growth factor for activated T and NK cells, enhance the lytic activity of NK/lymphokine-activated Killer cells, and stimulate the production of IFN-gamma by resting PBMC.
  • Sequence similarities

    Belongs to the IL-6 superfamily.
  • Cellular localization

    Secreted.
  • Information by UniProt

References

ab209156 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab209156.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up