Description

  • Product name

    Recombinant pig IL-17A protein
    See all IL-17A proteins and peptides
  • Biological activity

    The biological activity of ab209272 is determined by the secretion of IL-6 and IL-8 by CΔ2(-) cells after stimulation with IL-17A. Swine IL-6 and IL-8 were produced in a dose response and measured by ELISA or Luminex-based assay. Bioactivity is typically detected at 0.3 ng/mL steadily increasing through 100 ng/mL.

  • Purity

    > 95 % SDS-PAGE.
    ab209272 was purified by Ion-exchange chromatography.
  • Expression system

    Yeast
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Pig
    • Sequence

      GIMIPQSPGCPKTEDKNFPQHVRVNLNILNRSTPARRPSDYSKRSTSPWT LQRNEDPERYPSVIWEAKCSHSGCINAEGKEDHHMNSVPIQQEILVLRRE PRHCPNSFRLEKVMVTVGCTCVTPIVRHIS
    • Predicted molecular weight

      15 kDa
    • Amino acids

      24 to 153
    • Additional sequence information

      This product is the mature full length protein from aa 24 to 153. The signal peptide is not included.

Specifications

Our Abpromise guarantee covers the use of ab209272 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Functional Studies

    SDS-PAGE

  • Form

    Lyophilised
  • Additional notes

    ab209272 was produced in yeast and therefore does not have endotoxin, is naturally folded, and post-translationally modified.

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot. Store at -20°C. Avoid freeze / thaw cycle.

    Constituents: 90% PBS, 10% Trehalose

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

  • Reconstitution
    Reconstitute with sterile phosphate-buffered saline containing at least 0.1% carrier protein.

General Info

  • Alternative names

    • CTLA 8
    • CTLA-8
    • CTLA8
    • cytotoxic T lymphocyte associated antigen 8
    • Cytotoxic T lymphocyte associated protein 8
    • Cytotoxic T lymphocyte associated serine esterase 8
    • Cytotoxic T-lymphocyte-associated antigen 8
    • IL 17
    • IL 17A
    • IL-17
    • IL-17A
    • IL17
    • IL17_HUMAN
    • Il17a
    • Interleukin 17 (cytotoxic T lymphocyte associated serine esterase 8)
    • interleukin 17A
    • Interleukin-17A
    • interleukin17
    • Interleukin17A
    • OTTHUMP00000016597
    • OTTMUSP00000046003
    see all
  • Function

    Induces stromal cells to produce proinflammatory and hematopoietic cytokines. Enhances the surface expression of the intracellular adhesion molecule-1 (ICAM-1) in fibroblasts.
  • Tissue specificity

    Restricted to activated memory T-cells.
  • Sequence similarities

    Belongs to the IL-17 family.
  • Post-translational
    modifications

    Found both in glycosylated and nonglycosylated forms.
  • Cellular localization

    Secreted.
  • Information by UniProt

References

ab209272 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab209272.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up