Recombinant pig IL-2 protein (Active) (ab238292)
Key features and details
- Expression system: Escherichia coli
- Purity: > 95% SDS-PAGE
- Endotoxin level: <= 1.000 Eu/µg
- Active: Yes
- Suitable for: Functional Studies, SDS-PAGE
Description
-
Product name
Recombinant pig IL-2 protein (Active)
See all IL-2 proteins and peptides -
Biological activity
CTLL-2 cell proliferation ED50 ≤ 1 ng/mL (≥ 1.0 x 10^6 units/mg).
-
Purity
> 95 % SDS-PAGE. -
Endotoxin level
<=1.000 Eu/µg -
Expression system
Escherichia coli -
Accession
-
Protein length
Full length protein -
Animal free
Yes -
Nature
Recombinant -
-
Species
Pig -
Sequence
MAPTSSSTKNTKKQLEPLLLDLQLLLKEVKNYENADLSRMLTFKFYMPKQ ATELKHLQCLVEELKALEGVLNLGQSKNSDSANIKESMNNINVTVLELKG SETSFKCEYDDETVTAVEFLNKWITFCQSIYSTLT -
Predicted molecular weight
15 kDa -
Amino acids
21 to 154 -
Additional sequence information
Full length mature chain without signal peptide. Source: Genetically modified E.coli.
-
Specifications
Our Abpromise guarantee covers the use of ab238292 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
-
Applications
Functional Studies
SDS-PAGE
-
Form
Lyophilized -
Additional notes
12 months from date of receipt when stored at -20°C to -80°C as supplied.
1 month when stored at 4°C after reconstituting as directed.
3 months when stored at -20°C to -80°C after reconstituting as directed. -
Concentration information loading...
Preparation and Storage
-
Stability and Storage
Shipped at Room Temperature. Store at -20°C or -80°C. Avoid freeze / thaw cycle.
Constituent: 0.16% Sodium phosphate
Lyophilized from a sterile (0.2 micron) filtered aqueous solutionThis product is an active protein and may elicit a biological response in vivo, handle with caution.
-
ReconstitutionSterile water at 0.1 mg/mL. Centrifuge vial before opening. Suspend the product by gently pipetting the above recommended solution down the sides of the vial. DO NOT VORTEX. Allow several minutes for complete reconstitution. For prolonged storage, dilute to working aliquots in a 0.1% BSA solution, store at -80°C, and avoid repeat freeze thaws.
General Info
-
Alternative names
- Aldesleukin
- IL 2
- IL-2
see all -
Function
Produced by T-cells in response to antigenic or mitogenic stimulation, this protein is required for T-cell proliferation and other activities crucial to regulation of the immune response. Can stimulate B-cells, monocytes, lymphokine-activated killer cells, natural killer cells, and glioma cells. -
Involvement in disease
Note=A chromosomal aberration involving IL2 is found in a form of T-cell acute lymphoblastic leukemia (T-ALL). Translocation t(4;16)(q26;p13) with involves TNFRSF17. -
Sequence similarities
Belongs to the IL-2 family. -
Cellular localization
Secreted. - Information by UniProt
Images
-
CTLL-2 cell proliferation ED50 ≤ 1 ng/mL (≥ 1.0 x 10^6 units/mg).
-
Recombinant pig IL2 protein (Active) (ab238292) used at 1 µg.
4-20% Tris-Glycine gel, stained with Coomassie Blue.
Lane 1: Non-reducing conditions.
Lane 2: Reducing conditions.
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
References (0)
ab238292 has not yet been referenced specifically in any publications.