Overview

Description

  • Nature

    Recombinant
  • Source

    Yeast
  • Amino Acid Sequence
    • Accession
    • Species

      Pig
    • Sequence

      HKSSFQGQDRLLIRLRQLIDTVDQLKNYVHDLDPELLPAPEDVQRHCEQS AFSCFQKVELKSANTGDNEKIINVLIKQLKRKLPPTNAGRRQKHGLTCPT CDSYEKKPIKEFLERLKSLIQKMIHQHLS
    • Molecular weight

      15 kDa
    • Amino acids

      18 to 146
    • Additional sequence information

      This product is for the mature full length protein. The signal peptide is not included.

Associated products

Specifications

Our Abpromise guarantee covers the use of ab209364 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Purity

    > 95 % SDS-PAGE.
    Purified by ion-exchange chromatography.
  • Form

    Lyophilised
  • Additional notes

    ab209364 was produced in yeast and therefore does not have endotoxin, is naturally folded, and post-translationally modified.  It can be used in cell culture, as an IL-21 ELISA Standard, and as a Western Blot Control.

    Stable for up to twelve months from date of receipt at -20°C. Stable for at least 3 months when stored in working aliquots with a carrier protein at -20°C. Avoid repeated freeze/thaw cycle.

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.

    Constituents: 90% PBS, 10% Trehalose

  • Reconstitution
    Reconstitute with sterile PBS containing at least 0.1% carrier protein.

General Info

  • Alternative names

    • CVID11
    • IL 21
    • IL-21
    • Il21
    • IL21_HUMAN
    • Interleukin 21
    • Interleukin-21
    • interleukin-21 isoform
    • Interleukin21
    • OTTHUMP00000164088
    • Za11
    see all
  • Function

    Cytokine with immunoregulatory activity. May promote the transition between innate and adaptive immunity. Induces the production of IgG(1) and IgG(3) in B-cells (By similarity). May play a role in proliferation and maturation of natural killer (NK) cells in synergy with IL15. May regulate proliferation of mature B- and T-cells in response to activating stimuli. In synergy with IL15 and IL18 stimulates interferon gamma production in T-cells and NK cells. During T-cell mediated immune response may inhibit dendritic cells (DC) activation and maturation.
  • Tissue specificity

    Expressed in activated CD4-positive T-cells but not in CD8-positive T-cells, B-cells, or monocytes.
  • Sequence similarities

    Belongs to the IL-15/IL-21 family.
  • Cellular localization

    Secreted.
  • Information by UniProt

References

ab209364 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab209364.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up