Description

  • Product name

    Recombinant Pig IL-4 protein
    See all IL-4 proteins and peptides
  • Purity

    > 95 % SDS-PAGE.
    ab209276 was purified by Ion-exchange chromatography.
  • Expression system

    Yeast
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Pig
    • Sequence

      HKCDITLQEIIKTLNILTARKNSCMELPVTDVFAAPENTTEKETFCRAST VLRHIYRHHTCMKSLLSGLDRNLSSMANMTCSVHEAKKSTLKDFLERLKT IMKEKYSKC
    • Predicted molecular weight

      13 kDa
    • Amino acids

      25 to 133
    • Additional sequence information

      This product is the mature full length protein from aa 25 to 133. The signal peptide is not included.

Specifications

Our Abpromise guarantee covers the use of ab209276 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Lyophilised
  • Additional notes

    ab209276 was produced in yeast and therefore does not have endotoxin, is naturally folded, and post-translationally modified.

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot. Store at -20°C. Avoid freeze / thaw cycle.

    Constituents: 90% PBS, 10% Trehalose

  • Reconstitution
    Reconstitute with sterile phosphate-buffered saline containing at least 0.1% carrier protein.

General Info

  • Alternative names

    • B cell growth factor 1
    • B cell IgG differentiation factor
    • B Cell Stimulatory Factor 1
    • B-cell stimulatory factor 1
    • BCGF 1
    • BCGF1
    • Binetrakin
    • BSF-1
    • BSF1
    • IGG1 induction factor
    • IL 4
    • IL-4
    • IL4
    • IL4_HUMAN
    • Il4e12
    • Interleukin 4
    • Interleukin 4 variant 2
    • Interleukin 4, isoform 1
    • Interleukin-4
    • Lymphocyte stimulatory factor 1
    • MGC79402
    • Pitrakinra
    see all
  • Function

    Participates in at least several B-cell activation processes as well as of other cell types. It is a costimulator of DNA-synthesis. It induces the expression of class II MHC molecules on resting B-cells. It enhances both secretion and cell surface expression of IgE and IgG1. It also regulates the expression of the low affinity Fc receptor for IgE (CD23) on both lymphocytes and monocytes.
  • Involvement in disease

    Genetic variations in IL4 may be a cause of susceptibility to ischemic stroke (ISCHSTR) [MIM:601367]; also known as cerebrovascular accident or cerebral infarction. A stroke is an acute neurologic event leading to death of neural tissue of the brain and resulting in loss of motor, sensory and/or cognitive function. Ischemic strokes, resulting from vascular occlusion, is considered to be a highly complex disease consisting of a group of heterogeneous disorders with multiple genetic and environmental risk factors.
  • Sequence similarities

    Belongs to the IL-4/IL-13 family.
  • Cellular localization

    Secreted.
  • Information by UniProt

References

ab209276 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab209276.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up