Description

  • Product name

    Recombinant pig IL-4 protein (Active)
    See all IL-4 proteins and peptides
  • Biological activity

    TF-1 cell proliferation: ED50 ≤ 2 ng/mL (≥ 5.0 x 105 units/mg).

  • Purity

    > 95 % SDS-PAGE.

  • Endotoxin level

    <=1.000 Eu/µg
  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Pig
    • Sequence

      MHKCDITLQEIIKTLNILTARKNSCMELPVTDVFAAPENTTEKETFCRAS TVLRHIYRHHTCMKSLLSGLDRNLSSMANMTCSVHEAKKSTLKDFLERLK TIMKEKYSKC
    • Predicted molecular weight

      13 kDa
    • Amino acids

      25 to 133
    • Additional sequence information

      Full length mature chain without signal peptide. Genetically modified E.coli.

Specifications

Our Abpromise guarantee covers the use of ab233686 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Functional Studies

    SDS-PAGE

  • Form

    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at Room Temperature. Store at -20°C or -80°C.

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

  • Reconstitution
    Reconstitute with sterile water at 0.1 mg/ml. Centrifuge vial before opening. Suspend the product by gently pipetting the above recommended solution down the sides of the vial. DO NOT VORTEX. Allow several minutes for complete reconstitution. For prolonged storage, dilute to working aliquots in a 0.1% BSA solution, store at -80°C and avoid repeat freeze thaws.

General Info

  • Alternative names

    • B cell growth factor 1
    • B cell IgG differentiation factor
    • B Cell Stimulatory Factor 1
    • B-cell stimulatory factor 1
    • BCGF 1
    • BCGF1
    • Binetrakin
    • BSF-1
    • BSF1
    • IGG1 induction factor
    • IL 4
    • IL-4
    • IL4
    • IL4_HUMAN
    • Il4e12
    • Interleukin 4
    • Interleukin 4 variant 2
    • Interleukin 4, isoform 1
    • Interleukin-4
    • Lymphocyte stimulatory factor 1
    • MGC79402
    • Pitrakinra
    see all
  • Function

    Participates in at least several B-cell activation processes as well as of other cell types. It is a costimulator of DNA-synthesis. It induces the expression of class II MHC molecules on resting B-cells. It enhances both secretion and cell surface expression of IgE and IgG1. It also regulates the expression of the low affinity Fc receptor for IgE (CD23) on both lymphocytes and monocytes.
  • Involvement in disease

    Genetic variations in IL4 may be a cause of susceptibility to ischemic stroke (ISCHSTR) [MIM:601367]; also known as cerebrovascular accident or cerebral infarction. A stroke is an acute neurologic event leading to death of neural tissue of the brain and resulting in loss of motor, sensory and/or cognitive function. Ischemic strokes, resulting from vascular occlusion, is considered to be a highly complex disease consisting of a group of heterogeneous disorders with multiple genetic and environmental risk factors.
  • Sequence similarities

    Belongs to the IL-4/IL-13 family.
  • Cellular localization

    Secreted.
  • Information by UniProt

Images

  • Pig IL4 induced proliferation of TF-1 cells. ED50 ≤ 2 ng/mL (≥ 5.0 x 10^5 units/mg).

  • SDS-PAGE - Recombinant pig IL4 protein (Active) (ab233686) at 1 µg.
    Lane 1: Non-reducing conditions.
    Lane 2: Reducing conditions.
    4-20% Tris-Glycine gel stained with Coomassie Blue.
    Expected MW 12.7 kDa.

References

ab233686 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab233686.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up