For the best experience on the Abcam website please upgrade to a modern browser such as Google Chrome

We use cookies to make our site as useful as possible.

Our Cookie Policy explains how you can opt-out of the cookies we use.

If you continue without changing your cookie settings, we'll assume you’re happy with this.

Continue Continue

United States
Your country/region is currently set to:

If incorrect, please enter your country/region into the box below, to view site information related to your country/region.

Call (888) 77-ABCAM (22226) or contact us
Need help? Contact us

  • My account
  • Sign out
Sign in or Register with us

Welcome

Sign in or

Don't have an account?

Register with us
My basket
Quick order
Abcam homepage

  • Research Products
    By product type
    Primary antibodies
    Secondary antibodies
    ELISA and Matched Antibody Pair Kits
    Cell and tissue imaging tools
    Cellular and biochemical assays
    Proteins and Peptides
    By product type
    Proteomics tools
    Agonists, activators, antagonists and inhibitors
    Cell lines and Lysates
    Multiplex miRNA assays
    Multiplex Assays
    By research area
    Cancer
    Cardiovascular
    Cell Biology
    Epigenetics
    Metabolism
    Developmental Biology
    By research area
    Immunology
    Microbiology
    Neuroscience
    Signal Transduction
    Stem Cells
  • Diagnostic & Therapeutic Solutions
    Custom solutions & partnerships

    Custom antibody development and commercial partnerships to advance your diagnostic and therapeutic discovery.

    Create custom solutions with us

    Partner with us

  • Support
    Support hub

    Access advice and support for any research roadblock

    View support hub

    Protocols

    Your experiments laid out step by step

    View protocols

  • Events
    • Conference calendar
    • Cancer
    • Cardiovascular
    • Epigenetics & Nuclear signaling
    • Immunology
    • Neuroscience
    • Stem cells
    • Tradeshows
    • Scientific webinars
    Keep up to date with the latest events

    Full event breakdown with abstracts, speakers, registration and more

    View global event calendar

  • Pathways
    Cell signalling pathways

    View all pathways

    View all interactive pathways

Supporting our customers and employees during the COVID-19 pandemic. Read more

  1. Link

    recombinant-pig-p-cadherin-protein-his-tag-ab240870.pdf

  1. Send me a copy of this email
    I agree to the terms and conditions.
Signal Transduction Cytoskeleton / ECM Cell Adhesion Cadherins
Share by email

Recombinant Pig P cadherin protein (His tag) (ab240870)

  • Datasheet
Submit a review Submit a question

Product price, shipping and contact information

Currently unavailable

Sorry, we can't display this right now.

Please contact us to place your order, or try again later.

 

Loading size & price…

 

Shipping and order information

Abpromise

Guaranteed product quality, expert customer support.

Find out more.

SDS-PAGE - Recombinant Pig P cadherin protein (His tag) (ab240870)
  • Mass Spectrometry - Recombinant Pig P cadherin protein (His tag) (ab240870)
  • Mass Spectrometry - Recombinant Pig P cadherin protein (His tag) (ab240870)

Key features and details

  • Expression system: Yeast
  • Purity: > 85% SDS-PAGE
  • Tags: His tag N-Terminus
  • Suitable for: SDS-PAGE, MS

Description

  • Product name

    Recombinant Pig P cadherin protein (His tag)
    See all P cadherin proteins and peptides
  • Purity

    > 85 % SDS-PAGE.

  • Expression system

    Yeast
  • Accession

    O18926
  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Pig
    • Sequence

      KIAKYELFGHAVSENGASVEEPMNISIIVTDQNDHKPKFTQDVFRGSVLE GVLPGTSVMQVTATDEDDAINTYNGVVAYSILSQEPKDPHDLMFTVHRST GAISVISSGLDRERVPEYTLTIQATDMDGDGSSTTATAIVEILDA
    • Predicted molecular weight

      18 kDa including tags
    • Amino acids

      1 to 145
    • Tags

      His tag N-Terminus

Associated products

  • Related Products

    • Anti-6X His tag® antibody [HIS.H8] (ab18184)
    • Anti-6X His tag® antibody [4D11] (ab5000)
    • Anti-6X His tag® antibody (ab9108)

Specifications

Our Abpromise guarantee covers the use of ab240870 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry

    LC-MS/MS
  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    Constituents: Tris buffer, 50% Glycerol (glycerin, glycerine)

General Info

  • Alternative names

    • CADH3_HUMAN
    • Cadherin 3
    • Cadherin 3 precursor
    • Cadherin 3 type 1
    • Cadherin-3
    • Cadp
    • Calcium dependent adhesion protein placental
    • CDH 3
    • CDH3
    • CDH3 protein
    • CDHP
    • HJMD
    • P cadherin (placental)
    • P-cadherin
    • PCAD
    • Placental cadherin
    see all
  • Function

    Cadherins are calcium dependent cell adhesion proteins. They preferentially interact with themselves in a homophilic manner in connecting cells; cadherins may thus contribute to the sorting of heterogeneous cell types.
  • Tissue specificity

    Expressed in some normal epithelial tissues and in some carcinoma cell lines.
  • Involvement in disease

    Defects in CDH3 are the cause of hypotrichosis with juvenile macular dystrophy (HJMD) [MIM:601553]. HJMD is a rare autosomal recessive disorder characterized by early hair loss heralding severe degenerative changes of the retinal macula and culminating in blindness during the second to third decade of life.
    Defects in CDH3 are the cause of ectodermal dysplasia with ectrodactyly and macular dystrophy (EEM) [MIM:225280]; also known as EEM syndrome, Albrectsen-Svendsen syndrome or Ohdo-Hirayama-Terawaki syndrome. Ectodermal dysplasia defines a heterogeneous group of disorders due to abnormal development of two or more ectodermal structures. EEM is an autosomal recessive condition characterized by features of ectodermal dysplasia such as sparse eyebrows and scalp hair, and selective tooth agenesis associated with macular dystrophy and ectrodactyly.
  • Sequence similarities

    Contains 5 cadherin domains.
  • Cellular localization

    Cell membrane.
  • Target information above from: UniProt accession P22223 The UniProt Consortium
    The Universal Protein Resource (UniProt) in 2010
    Nucleic Acids Res. 38:D142-D148 (2010) .

    Information by UniProt

Images

  • SDS-PAGE - Recombinant Pig P cadherin protein (His tag) (ab240870)
    SDS-PAGE - Recombinant Pig P cadherin protein (His tag) (ab240870)

    (Tris-Glycine gel) Discontinuous SDS-PAGE with 5% enrichment gel and 15% separation gel analysis of ab240870.

    Lane 1: 45 & 22 kDa by EndoH digestion.

    Lane 2: 58 & 35 kDa.

    The reducing (R) protein migrates as 58 & 35 kDa in SDS-PAGE may be due to glycosylation and homodimer.

  • Mass Spectrometry - Recombinant Pig P cadherin protein (His tag) (ab240870)
    Mass Spectrometry - Recombinant Pig P cadherin protein (His tag) (ab240870)

    Based on the SEQUEST from database of Yeast host and target protein, the LC-MS/MS Analysis result of ab240870 could indicate that this peptide derived from Yeast-expressed Sus scrofa (Pig) P cadherin.

  • Mass Spectrometry - Recombinant Pig P cadherin protein (His tag) (ab240870)
    Mass Spectrometry - Recombinant Pig P cadherin protein (His tag) (ab240870)

    Based on the SEQUEST from database of Yeast host and target protein, the LC-MS/MS Analysis result of ab240870 could indicate that this peptide derived from Yeast-expressed Sus scrofa (Pig) P cadherin.

Protocols

To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.

Click here to view the general protocols

Datasheets and documents

    • Datasheet
  • References (0)

    Publishing research using ab240870? Please let us know so that we can cite the reference in this datasheet.

    ab240870 has not yet been referenced specifically in any publications.

    Customer reviews and Q&As

    Show All Reviews Q&A
    Submit a review Submit a question

    There are currently no Customer reviews or Questions for ab240870.
    Please use the links above to contact us or submit feedback about this product.

    Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
    For licensing inquiries, please contact partnerships@abcam.com

    Get resources and offers direct to your inbox Sign up
    A-Z by research area
    • Cancer
    • Cardiovascular
    • Cell biology
    • Developmental biology
    • Epigenetics & Nuclear signaling
    • Immunology
    • Metabolism
    • Microbiology
    • Neuroscience
    • Signal transduction
    • Stem cells
    A-Z by product type
    • Primary antibodies
    • Secondary antibodies
    • Biochemicals
    • Isotype controls
    • Flow cytometry multi-color selector
    • Kits
    • Loading controls
    • Lysates
    • Peptides
    • Proteins
    • Slides
    • Tags and cell markers
    • Tools & Reagents
    Help & support
    • Support
    • Make an Inquiry
    • Protocols & troubleshooting
    • Placing an order
    • RabMAb products
    • Biochemical product FAQs
    • Training
    • Browse by Target
    Company
    • Corporate site
    • Investor relations
    • Company news
    • Careers
    • About us
    • Blog
    Events
    • Tradeshows
    • Conferences
    International websites
    • abcam.cn
    • abcam.co.jp

    Join with us

    • LinkedIn
    • facebook
    • Twitter
    • YouTube
    • Terms of sale
    • Website terms of use
    • Cookie policy
    • Privacy policy
    • Legal
    • Modern slavery statement
    © 1998-2021 Abcam plc. All rights reserved.