Recombinant Pig P cadherin protein (His tag) (ab240870)
Key features and details
- Expression system: Yeast
- Purity: > 85% SDS-PAGE
- Tags: His tag N-Terminus
- Suitable for: SDS-PAGE, MS
Description
-
Product name
Recombinant Pig P cadherin protein (His tag)
See all P cadherin proteins and peptides -
Purity
> 85 % SDS-PAGE. -
Expression system
Yeast -
Accession
-
Protein length
Full length protein -
Animal free
No -
Nature
Recombinant -
-
Species
Pig -
Sequence
KIAKYELFGHAVSENGASVEEPMNISIIVTDQNDHKPKFTQDVFRGSVLE GVLPGTSVMQVTATDEDDAINTYNGVVAYSILSQEPKDPHDLMFTVHRST GAISVISSGLDRERVPEYTLTIQATDMDGDGSSTTATAIVEILDA -
Predicted molecular weight
18 kDa including tags -
Amino acids
1 to 145 -
Tags
His tag N-Terminus
-
Associated products
-
Related Products
Specifications
Our Abpromise guarantee covers the use of ab240870 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
-
Applications
SDS-PAGE
Mass Spectrometry
-
Mass spectrometry
LC-MS/MS -
Form
Liquid -
Concentration information loading...
Preparation and Storage
-
Stability and Storage
Shipped at 4°C. Store at -20°C or -80°C. Avoid freeze / thaw cycle.
Constituents: Tris buffer, 50% Glycerol (glycerin, glycerine)
General Info
-
Alternative names
- CADH3_HUMAN
- Cadherin 3
- Cadherin 3 precursor
see all -
Function
Cadherins are calcium dependent cell adhesion proteins. They preferentially interact with themselves in a homophilic manner in connecting cells; cadherins may thus contribute to the sorting of heterogeneous cell types. -
Tissue specificity
Expressed in some normal epithelial tissues and in some carcinoma cell lines. -
Involvement in disease
Defects in CDH3 are the cause of hypotrichosis with juvenile macular dystrophy (HJMD) [MIM:601553]. HJMD is a rare autosomal recessive disorder characterized by early hair loss heralding severe degenerative changes of the retinal macula and culminating in blindness during the second to third decade of life.
Defects in CDH3 are the cause of ectodermal dysplasia with ectrodactyly and macular dystrophy (EEM) [MIM:225280]; also known as EEM syndrome, Albrectsen-Svendsen syndrome or Ohdo-Hirayama-Terawaki syndrome. Ectodermal dysplasia defines a heterogeneous group of disorders due to abnormal development of two or more ectodermal structures. EEM is an autosomal recessive condition characterized by features of ectodermal dysplasia such as sparse eyebrows and scalp hair, and selective tooth agenesis associated with macular dystrophy and ectrodactyly. -
Sequence similarities
Contains 5 cadherin domains. -
Cellular localization
Cell membrane. - Information by UniProt
Images
-
(Tris-Glycine gel) Discontinuous SDS-PAGE with 5% enrichment gel and 15% separation gel analysis of ab240870.
Lane 1: 45 & 22 kDa by EndoH digestion.
Lane 2: 58 & 35 kDa.
The reducing (R) protein migrates as 58 & 35 kDa in SDS-PAGE may be due to glycosylation and homodimer.
-
Based on the SEQUEST from database of Yeast host and target protein, the LC-MS/MS Analysis result of ab240870 could indicate that this peptide derived from Yeast-expressed Sus scrofa (Pig) P cadherin.
-
Based on the SEQUEST from database of Yeast host and target protein, the LC-MS/MS Analysis result of ab240870 could indicate that this peptide derived from Yeast-expressed Sus scrofa (Pig) P cadherin.
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
References (0)
ab240870 has not yet been referenced specifically in any publications.