Description

  • Product name

    Recombinant Pig PBR protein (Tagged)
    See all PBR proteins and peptides
  • Purity

    > 85 % SDS-PAGE.
    Purified from an in vitro E.coli expression system.
  • Expression system

    Cell free
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Pig
    • Sequence

      MAPPWLPAVGFTLVPSLGGFLSSRNVLGKGLHWYAGLQKPSWHPPHWTLA PIWGTLYSAMGYGSYMIWKELGGFSEEAVVPLGLYAGQLALNWAWPPLFF GARQMGWALVDLVLTGGVAAATAVAWYQVSPLAARLLYPYLAWLAFAATL NYCVWRDNQGRRGGRRPSE
    • Predicted molecular weight

      39 kDa including tags
    • Amino acids

      1 to 169
    • Tags

      His tag N-Terminus
    • Additional sequence information

      N-terminal 10xHis-SUMO-tagged and C-terminal Myc-tagged. In vitro E. coli expression system.

Specifications

Our Abpromise guarantee covers the use of ab235614 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    Constituents: Tris buffer, 50% Glycerol

General Info

  • Alternative names

    • Benzodiazapine receptor (peripheral)
    • Benzodiazepine peripheral binding site
    • BPBS
    • BZRP
    • DBI
    • IBP
    • Isoquinoline carboxamide-binding protein
    • MBR
    • mDRC
    • Mitochondrial benzodiazepine receptor
    • PBR
    • PBS
    • Peripheral benzodiazepine receptor
    • Peripheral benzodiazepine receptor-related protein
    • Peripheral type benzodiazepine receptor
    • Peripheral-type benzodiazepine receptor
    • pk18
    • PKBS
    • PTBR
    • Ptbzr
    • PTBZR02
    • RATPTBZR02
    • Translocator protein
    • translocator protein (18kDa)
    • Tspo
    • Tspo1
    • TSPOA_HUMAN
    see all
  • Function

    Responsible for the manifestation of peripheral-type benzodiazepine recognition sites and is most likely to comprise binding domains for benzodiazepines and isoquinoline carboxamides. May play a role in the transport of porphyrins and heme. Plays a role in the transport of cholesterol across mitochondrial membranes in steroidogenic cells.
  • Tissue specificity

    Found in many tissue types. Expressed at the highest levels under normal conditions in tissues that synthesize steroids.
  • Sequence similarities

    Belongs to the TspO/BZRP family.
  • Cellular localization

    Mitochondrion membrane.
  • Information by UniProt

Images

  • ab235614 analyzed by (Tris-Glycine gel) discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

References

ab235614 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab235614.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up