Description

  • Product name

    Recombinant Pollen major allergen 1-1 protein
    See all Pollen major allergen 1-1 proteins and peptides
  • Purity

    > 90 % SDS-PAGE.

  • Expression system

    Yeast
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Sequence

      DNPIDSCWRGDSNWDQNRMKLADCAVGFGSSTMGGKGGDFYTVTSTDDNP VNPTPGTLRYGATREKALWIIFSQNMNIKLKMPLYVAGHKTIDGRGADVH LGNGGPCLFMRKVSHVILHSLHIHGCNTSVLGDVLVSESIGVEPVHAQDG DAITMRNVTNAWIDHNSLSDCSDGLIDVTLGSTGITISNNHFFNHHKVML LGHDDTYDDDKSMKVTVAFNQFGPNAGQRMPRARYGLVHVANNNYDPWNI YAIGGSSNPTILSEGNSFTAPSESYKKEVTKRIGCESPSACANWVWRSTR DAFINGAYFVSSGKTEETNIYNSNEAFKVENGNAAPQLTKNAGVVT
    • Predicted molecular weight

      38 kDa including tags
    • Amino acids

      22 to 367
    • Additional sequence information

      Full length mature chain without signal peptide. Juniperus ashei (Ozark white cedar)

Specifications

Our Abpromise guarantee covers the use of ab226242 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    Constituents: Tris buffer, 50% Glycerol

General Info

  • Alternative names

    • Major pollen allergen Jun a 1
  • Relevance

    Pollen major allergen 1-1 belongs to the polysaccharide lyase 1 family, Amb a subfamily. It causes several seasonal allergis rhinitis in humans.

References

ab226242 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab226242.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up