Overview

  • Product name

    Recombinant Pollen major allergen 2 protein (His tag)
  • Protein length

    Full length protein

Description

  • Nature

    Recombinant
  • Source

    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species

      Japanese cedar
    • Sequence

      RKVEHSRHDAINIFNVEKYGAVGDGKHDCTEAFSTAWQAACKKPSAMLLV PGNKKFVVNNLFFNGPCQPHFTFKVDGIIAAYQNPASWKNNRIWLQFAKL TGFTLMGKGVIDGQGKQWWAGQCKWVNGREICNDRDRPTAIKFDFSTGLI IQGLKLMNSPEFHLVFGNCEGVKIIGISITAPRDSPNTDGIDIFASKNFH LQKNTIGTGDDCVAIGTGSSNIVIEDLICGPGHGISIGSLGRENSRAEVS YVHVNGAKFIDTQNGLRIKTWQGGSGMASHIIYENVEMINSENPILINQF YCTSASACQNQRSAVQIQDVTYKNIRGTSATAAAIQLKCSDSMPCKDIKL SDISLKLTSGKIASCLNDNANGYFSGHVIPACKNLSPS
    • Molecular weight

      58 kDa including tags
    • Amino acids

      46 to 433
    • Tags

      His tag N-Terminus
    • Additional sequence information

      This product is the mature full length protein with a 6xHis-SUMO tag at the N-terminus. The signal peptide and propeptides are not included.

Specifications

Our Abpromise guarantee covers the use of ab226313 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Purity

    > 90 % SDS-PAGE.

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    Constituents: 50% Glycerol, Tris buffer

General Info

  • Alternative names

    • JNA2
    • Major pollen allergen Jun a 2
    • Pectinase
    • Polygalacturonase
  • Relevance

    Pollen major allergen 2 causes an allergic reaction in humans. It belongs to the glycosyl hydrolase 28 family. Its catalytic activity is random hydrolysis of 1,4-alpha-D-galactosiduronic linkages in pectate and other galacturonans.
  • Cellular localization

    Secreted

Images

  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) analysis of ab226313 with 5% enrichment gel and 15% separation gel.

References

ab226313 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab226313.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up