Recombinant Porin like protein BUsg_347 (Tagged) (ab239437)

Description

  • Product name

    Recombinant Porin like protein BUsg_347 (Tagged)
  • Purity

    > 85 % SDS-PAGE.

  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Sequence

      IEIFNKNGNKLELYGSINPNHNFSNEFLSTKISSKEDNTNAILGLSGKIK ITDKLSSYAQIEYKNNFFMPEDLMNKQQPNTVRLGYAGLKYGNLGSIDYG RNYGVIHDAQSLTDHVPYINKKSIFAYNDNYMVGRNHSLLTYRNNNVFGL VDGISFALQYQDEIKNRDLNKGKSSSGWGASLKYESDSGLTAVGSCFTSE RMISSNKKDLKNTSVDSYGLGFKYDANNVYVAAFYGSARNLMPYNMHISD SFINETQNIEAIAEYSFDSGFHPSLSYLDSKGQNSNSPKKELDLAKQINI STRYEFNKNVSTYMNYKINLLKENDFISQNQIPTDNTIGAGVVYQF
    • Predicted molecular weight

      59 kDa including tags
    • Amino acids

      24 to 369
    • Tags

      His tag N-Terminus
    • Additional sequence information

      Buchnera aphidicola subsp. Schizaphis graminum (strain Sg). Full-length mature chain lacking the signal peptide. N-terminal 10xHis-SUMO-tagged and C-terminal Myc-tagged.

Specifications

Our Abpromise guarantee covers the use of ab239437 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    Constituents: Tris buffer, 50% Glycerol

Images

  • ab239437 analyzed by (Tris-Glycine gel) discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

References

ab239437 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab239437.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up