Recombinant Probable non-specific lipid-transfer protein 2 (Tagged) (ab236999)

Overview

  • Product name

    Recombinant Probable non-specific lipid-transfer protein 2 (Tagged)
  • Protein length

    Full length protein

Description

  • Nature

    Recombinant
  • Source

    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Sequence

      EEACGKVVQDIMPCLHFVKGEEKEPSKECCSGTKKLSEEVKTTEQKREAC KCIVRATKGISGIKNELVAEVPKKCDIKTTLPPITADFDCSKIQSTIFRG YY
    • Molecular weight

      27 kDa including tags
    • Amino acids

      32 to 133
    • Additional sequence information

      Parietaria judaica (Pellitory-of-the-wall) (Parietaria diffusa). N-terminal 6xHis-SUMO-tagged. Full length mature chain without signal peptide.

Specifications

Our Abpromise guarantee covers the use of ab236999 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Purity

    >= 85 % SDS-PAGE.

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    Constituents: Tris buffer, 50% Glycerol

Images

  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel analysis of ab236999.

References

ab236999 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab236999.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up