Recombinant Protein ORF3 (Tagged) (ab238356)

Description

  • Product name

    Recombinant Protein ORF3 (Tagged)
  • Purity

    > 90 % SDS-PAGE.

  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Hepatitis E virus
    • Sequence

      MGSRPWALGLFCCCSSCFCLCCSRHRPVSRLAAVVGGAAAVPAVVSGVTG LILSPSQSPIFIQPTPSPRMSPLRPGLDLVFANPSDHSAPLGATRPSAPP LPHVVDLPQLGPRR
    • Predicted molecular weight

      28 kDa including tags
    • Amino acids

      1 to 114
    • Tags

      His tag N-Terminus
    • Additional sequence information

      Genotype 1 (isolate Human/India/Hyderabad) (HEV-1). N-terminal 6xHis-SUMO-tag.

Specifications

Our Abpromise guarantee covers the use of ab238356 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    Constituents: Tris buffer, 50% Glycerol

General Info

  • Relevance

    May act as a viral regulatory protein involved in the modulation of mitogenic signaling pathways. May be involved in virion morphogenesis and viral pathogenesis. Expedites the processing and secretion of AMBP from the hepatocyte.

Images

  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) analysis with 5% enrichment gel and 15% separation gel of ab238356.

References

ab238356 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab238356.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up