Recombinant Pseudomonas aeruginosa ompF protein (His tag) (ab236164)

Description

  • Product name

    Recombinant Pseudomonas aeruginosa ompF protein (His tag)
  • Purity

    > 85 % SDS-PAGE.

  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Pseudomonas aeruginosa
    • Sequence

      QGQNSVEIEAFGKRYFTDSVRNMKNADLYGGSIGYFLTDDVELALSYGEY HDVRGTYETGNKKVHGNLTSLDAIYHFGTPGVGLRPYVSAGLAHQNITNI NSDSQGRQQMTMANIGAGLKYYFTENFFAKASLDGQYGLEKRDNGHQGEW MAGLGVGFNFGGSKAAPAPEPVADVCSDSDNDGVCDNVDKCPDTPANVTV DANGCPAVAEVVRVQLDVKFDFDKSKVKENSYADIKNLADFMKQYPSTST TVEGHTDSVGTDAYNQKLSERRANAVRDVLVNEYGVEGGRVNAVGYGESR PVADNATAEGRAINRRVEAEVEAEAK
    • Predicted molecular weight

      39 kDa including tags
    • Amino acids

      25 to 350
    • Tags

      His tag N-Terminus
    • Additional sequence information

      This product is the mature full length protein from aa 25 to 350. The signal peptide is not included.

Specifications

Our Abpromise guarantee covers the use of ab236164 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    Constituents: Tris buffer, 50% Glycerol

General Info

  • Alternative names

    • orpF
    • Putative outer membrane porin F protein
    • YE1563
  • Cellular localization

    Cell Membrane

Images

  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) analysis with 5% enrichment gel and 15% separation gel analysis of ab236164.

References

ab236164 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab236164.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up