Recombinant Putative Serine Protease Inhibitor protein (Tagged) (ab224865)

Description

  • Product name

    Recombinant Putative Serine Protease Inhibitor protein (Tagged)
  • Purity

    > 90 % SDS-PAGE.

  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Wuchereria bancrofti
    • Sequence

      ILGQISLTDRAQLDFAVNLLQNVAESDRSSILSPFSVSTSLFIAYLAADG ETKQQLQNALGKTASTSQFRIHFAKQLAYLARAESRNYTLNVANRFYVRE EFSTKESFQRVLSFYYNEILYKFNFEQRNELVQEINDWVSNETNNKVTKM ITENSITEDTRMLLMNAIHFKGTWTTQFIDFVTKQKQFHISENEVKLVPM MAKSDTVPYYEDDVVKVIKLPYTGGEVEMVVILPKRRFGLSDVLKNLSGE KLLKYVNEAKNRTVSIRMPRFQVEEKRNLNNALQAIGITDAFSGKADFGE LLNNSIPISIGKIIHAGFIEVNEKGTESAAATLIELEDRMASSRNFNADE PFLFAIVKDLKTVLFIGQFVK
    • Predicted molecular weight

      62 kDa including tags
    • Amino acids

      1 to 371
    • Tags

      His tag N-Terminus
    • Additional sequence information

      Wuchereria bancrofti protein with a 10xHis-SUMO tag at the N-terminus and Myc tag at the C-terminus.

Specifications

Our Abpromise guarantee covers the use of ab224865 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry

    LC-MS/MS
  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    Constituents: 50% Glycerol, Tris buffer

Images

  • Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS analysis result of ab224865 could indicate that this peptide derived from E.coli-expressed Wuchereria bancrofti wb123.

  • Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS analysis result of ab224865 could indicate that this peptide derived from E.coli-expressed Wuchereria bancrofti wb123.

References

ab224865 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab224865.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up