Description

  • Product name

    Recombinant Rabbit APRIL/TNFSF13 protein
    See all APRIL/TNFSF13 proteins and peptides
  • Expression system

    Yeast
  • Accession

  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Rabbit
    • Sequence

      ALPTQKQKKKRSLLHLVPINITSKEDSDVTEVMWQPALRRGRGLEAQGYV VRVWDTGVYLLYSQVLFHDVTFTMGQVVSREGQGRQETLFRCVCSMPSDP DRAYNSCYSAGVFHLHQGDILSVVIPRARAKFSLSPHGTFLGFVKL
    • Predicted molecular weight

      17 kDa
    • Amino acids

      105 to 250

Specifications

Our Abpromise guarantee covers the use of ab209395 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Lyophilised
  • Additional notes

    ab209395 was produced in yeast and therefore does not have endotoxin, is naturally folded, and post-translationally modified.

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon reconsitution add a carrier protein (0.1% BSA). Store at -20°C long term. Avoid freeze / thaw cycle.

    Constituents: 10% Trehalose, 90% PBS

  • Reconstitution
    Reconstitute with sterile phosphate-buffered saline containing at least 0.1% carrier protein. Stable for up to twelve months from date of receipt at -20°C. Stable for at least 3 months when stored in working aliquots with a carrier protein at -20°C. Avoid repeated freeze/thaw cycle.

General Info

  • Alternative names

    • A proliferation inducing ligand
    • A proliferation-inducing ligand
    • APRIL
    • CD256
    • TALL-2
    • TALL2
    • TNF related death ligand
    • TNF- and APOL-related leukocyte expressed ligand 2
    • TNF-related death ligand 1
    • TNF13_HUMAN
    • TNFSF13
    • TRDL-1
    • TRDL1
    • Tumor necrosis factor (ligand) superfamily, member 13
    • Tumor necrosis factor ligand superfamily member 13
    • Tumor necrosis factor like protein ZTNF2
    • Tumor necrosis factor related death ligand 1
    • UNQ383/PRO715
    • ZTNF2
    see all
  • Function

    Cytokine that binds to TNFRSF13B/TACI and to TNFRSF17/BCMA. May be implicated in the regulation of tumor cell growth. May be involved in monocyte/macrophage-mediated immunological processes.
  • Tissue specificity

    Expressed at high levels in transformed cell lines, cancers of colon, thyroid, lymphoid tissues and specifically expressed in monocytes and macrophages.
  • Sequence similarities

    Belongs to the tumor necrosis factor family.
  • Post-translational
    modifications

    The precursor is cleaved by furin.
  • Cellular localization

    Secreted.
  • Information by UniProt

References

ab209395 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab209395.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up