For the best experience on the Abcam website please upgrade to a modern browser such as Google Chrome

Hello. We're improving abcam.com and we'd welcome your feedback.

Hello. We're improving abcam.com and we'd welcome your feedback.

Infomation icon

We haven't added this to the BETA yet

New BETA website

New BETA website

Hello. We're improving abcam.com and we'd welcome your feedback.

Take a look at our BETA site and see what we’ve done so far.

Switch on our new BETA site

Now available

Search and browse selected products

  • A selection of primary antibodies

Purchase these through your usual distributor

In the coming months

  • Additional product types
  • Supporting content
  • Sign in to your account
  • Purchase online
United States
Your country/region is currently set to:

If incorrect, please enter your country/region into the box below, to view site information related to your country/region.

Call (888) 77-ABCAM (22226) or contact us
Need help? Contact us

  • My account
  • Sign out
Sign in or Register with us

Welcome

Sign in or

Don't have an account?

Register with us
My basket
Quick order
Abcam homepage

  • Research Products
    By product type
    Primary antibodies
    Secondary antibodies
    ELISA and Matched Antibody Pair Kits
    Cell and tissue imaging tools
    Cellular and biochemical assays
    Proteins and Peptides
    By product type
    Proteomics tools
    Agonists, activators, antagonists and inhibitors
    Cell lines and Lysates
    Multiplex miRNA assays
    Multiplex Assays
    By research area
    Cancer
    Cardiovascular
    Cell Biology
    Epigenetics
    Metabolism
    Developmental Biology
    By research area
    Immunology
    Microbiology
    Neuroscience
    Signal Transduction
    Stem Cells
  • Customized Products & Partnerships
    Customized Products & Partnerships

    Customized products and commercial partnerships to accelerate your diagnostic and therapeutic programs.

    Customized products

    Partner with us

  • Support
    Support hub

    Access advice and support for any research roadblock

    View support hub

    Protocols

    Your experiments laid out step by step

    View protocols

  • Events
    • Conference calendar
    • Cancer
    • Cardiovascular
    • Epigenetics & Nuclear signaling
    • Immunology
    • Neuroscience
    • Stem cells
    • Tradeshows
    • Scientific webinars
    Keep up to date with the latest events

    Full event breakdown with abstracts, speakers, registration and more

    View global event calendar

  • Pathways
    Cell signalling pathways

    View all pathways

    View all interactive pathways

  1. Link

    recombinant-rabbit-calreticulin-protein-ab15729.pdf

  1. Send me a copy of this email
    I agree to the terms and conditions.
Tags & Cell Markers Subcellular Markers Organelles ER
Share by email

Recombinant Rabbit Calreticulin protein (ab15729)

  • Datasheet
Submit a review Q&A (6)References (4)

Product price, shipping and contact information

Currently unavailable

Sorry, we can't display this right now.

Please contact us to place your order, or try again later.

 

Loading size & price…

 

Shipping and order information

Shipping info

Promotion Information

Abpromise

Guaranteed product quality, expert customer support.

Find out more.

SDS-PAGE - Recombinant Calreticulin protein (ab15729)

    Key features and details

    • Expression system: Escherichia coli
    • Suitable for: WB, ELISA

    You may also be interested in

    Primary
    Product image
    Alexa Fluor® 647 Anti-HLA-DR antibody [TAL 1B5] (ab223907)
    Primary
    Product image
    Anti-Calreticulin antibody [FMC 75] (ab22683)
    Primary
    Product image
    Anti-Calreticulin antibody [EPR3924] - ER Marker (ab92516)

    View more associated products

    Description

    • Product name

      Recombinant Rabbit Calreticulin protein
      See all Calreticulin proteins and peptides
    • Expression system

      Escherichia coli
    • Accession

      P15253
    • Protein length

      Full length protein
    • Animal free

      No
    • Nature

      Recombinant
      • Species

        Rabbit
      • Sequence

        MLLPVPLLLGLLGLAAAEPVVYFKEQFLDGDGWTERWIESKHKSDFGKFV LSSGKFYGDQEKDKGLQTSQDARFYALSARFEPFSNKGQPLVVQFTVKHE QNIDCGGGYVKLFPAGLDQKDMHGDSEYNIMFGPDICGPGTKKVHVIFNY KGKNVLINKDIRCKDDEFTHLYTLIVRPDNTYEVKIDNSQVESGSLEDDW DFLPPKKIKDPDASKPEDWDERAKIDDPTDSKPEDWDKPEHIPDPDAKKP EDWDEEMDGEWEPPVIQNPEYKGEWKPRQIDNPDYKGTWIHPEIDNPEYS PDANIYAYDSFAVLGLDLWQVKSGTIFDNFLITNDEAYAEEFGNETWGVT KTAEKQMKDKQDEEQRLKEEEEEKKRKEEEEAEEDEEDKDDKEDEDEDEE DKDEEEEEAAAGQAKDEL
      • Predicted molecular weight

        60 kDa
      • Amino acids

        1 to 418
      • Additional sequence information

        Molecular weight based on amino acid composition. The protein migrates as ~60 KdA protein in the SDS-PAGE due to reduced SDS binding (highly acidic C-terminus).

    Specifications

    Our Abpromise guarantee covers the use of ab15729 in the following tested applications.

    The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

    • Applications

      Western blot

      ELISA

    • Form

      Liquid
    • Additional notes

      Purified full length rabbit Calreticulin protein. SwissProt ID P15253.

    • Concentration information loading...

    Preparation and Storage

    • Stability and Storage

      Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.

      Constituent: PBS

    General Info

    • Alternative names

      • Autoantigen RO
      • CALR
      • CALR protein
      • CALR_HUMAN
      • Calregulin
      • Calreticulin
      • cC1qR
      • CRP55
      • CRT
      • CRTC
      • Endoplasmic reticulum resident protein 60
      • Epididymis secretory sperm binding protein Li 99n
      • ERp60
      • FLJ26680
      • grp60
      • HACBP
      • HEL S 99n
      • RO
      • Sicca syndrome antigen A
      • Sicca syndrome antigen A (autoantigen Ro; calreticulin)
      • SSA
      see all
    • Function

      Molecular calcium-binding chaperone promoting folding, oligomeric assembly and quality control in the ER via the calreticulin/calnexin cycle. This lectin interacts transiently with almost all of the monoglucosylated glycoproteins that are synthesized in the ER. Interacts with the DNA-binding domain of NR3C1 and mediates its nuclear export.
    • Sequence similarities

      Belongs to the calreticulin family.
    • Domain

      Can be divided into a N-terminal globular domain, a proline-rich P-domain forming an elongated arm-like structure and a C-terminal acidic domain. The P-domain binds one molecule of calcium with high affinity, whereas the acidic C-domain binds multiple calcium ions with low affinity.
      The interaction with glycans occurs through a binding site in the globular lectin domain.
      The zinc binding sites are localized to the N-domain.
      Associates with PDIA3 through the tip of the extended arm formed by the P-domain.
    • Cellular localization

      Endoplasmic reticulum lumen. Cytoplasm > cytosol. Secreted > extracellular space > extracellular matrix. Cell surface. Also found in cell surface (T cells), cytosol and extracellular matrix. Associated with the lytic granules in the cytolytic T-lymphocytes.
    • Target information above from: UniProt accession P27797 The UniProt Consortium
      The Universal Protein Resource (UniProt) in 2010
      Nucleic Acids Res. 38:D142-D148 (2010) .

      Information by UniProt

    Images

    • SDS-PAGE - Recombinant Calreticulin protein (ab15729)
      SDS-PAGE - Recombinant Calreticulin protein (ab15729)
      Coomassie stain of SDS-PAGE gel with ab15729.

    Protocols

    To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.

    Click here to view the general protocols

    Datasheets and documents

    • Datasheet download

      Download

    References (4)

    Publishing research using ab15729? Please let us know so that we can cite the reference in this datasheet.

    ab15729 has been referenced in 4 publications.

    • Zhang Y  et al. Engineering Calreticulin-Targeting Monobodies to Detect Immunogenic Cell Death in Cancer Chemotherapy. Cancers (Basel) 13:N/A (2021). PubMed: 34199835
    • Ihara Y  et al. Calnexin/Calreticulin and Assays Related to N-Glycoprotein Folding In Vitro. Methods Mol Biol 2132:295-308 (2020). PubMed: 32306337
    • Dudek-Peric AM  et al. Antitumor immunity triggered by melphalan is potentiated by melanoma cell surface-associated calreticulin. Cancer Res 75:1603-14 (2015). PubMed: 25762540
    • Cheng WF  et al. Tumor-specific immunity and antiangiogenesis generated by a DNA vaccine encoding calreticulin linked to a tumor antigen. J Clin Invest 108:669-78 (2001). PubMed: 11544272

    Customer reviews and Q&As

    Show All Reviews Q&A
    Submit a question

    1-6 of 6 Q&A

    Question

    Hope you've been well, I have a customer who has purchased product# ab15729, and she is using it in western blotting, and wants to know the molecular weight predicted for the detected band, if the product should be used in a reduced or non- reduced form, and the concentration used in the WB to get the bands shown in the picture on the datasheet. Please let me know if you have any suggestions.

    Read More

    Abcam community

    Verified customer

    Asked on Aug 21 2006

    Answer

    Thank you for your enquiry regarding this Calreticulin protein (ab15729). The MW of this recombinant protein is >47kDa, (however it migrates on SDS-PAGE as an approximately 60-kDa protein band). I would suggest loading 2-5 ug per lane. It will require reducing before running on a western blot. Most antibodies recognise reduced and denatured forms of the protein target in western blotting, unless stated otherwise on our datasheets. I hope this helps!

    Read More

    Abcam Scientific Support

    Answered on Aug 22 2006

    Question

    >Regarding ab15729, could you please provide the exact sequence >inforamtion on the calrecticulin (and tags) used. I've read the >reference (Wen-Fang Cheng et al) and found that it is a rabbit >calcrecticulin. The customer insists that Abcam provides/confirms >the exact sequences of the recombinant protein+tag that was used in >the production ab15729. > >As the customer's experiments are dependent on this data, could you >please be so kind to provide this information.

    Read More

    Abcam community

    Verified customer

    Asked on Jul 20 2006

    Answer

    Dear Dr. Hill, Thank you for your patience. Below is the amino acid sequence for ab15729. This rabbit calreticulin protein carries a myc-tag and his-tag at the C-terminus. I hope this information helps with the Mass Spectroscopy experiments. E P V V Y F K E Q F L D G D G W T E R W I E S K H K S D F G K F V L S S G K F Y G D Q E K D K G L Q T S Q D A R F Y A L S A R F E P F S N K G Q P L V V Q F T V K H E Q N I D C G G G Y V K L F P A G L D Q K D M H G D S E Y N I M F G P D I C G P G T K K V H V I F N Y K G K N V L I N K D I R C K D D E F T H L Y T L I V R P D N T Y E V K I D N S Q V E S G S L E D D W D F L P P K K I K D P D A S K P E D W D E R A K I D D P T D S K P E D W D K P E H I P D P D A K K P E D W D E E M D G E W E P P V I Q N P E Y K G E W K P R Q I D N P D Y K G T W I H P E I D N P E Y S P D A N I Y A Y D S F A V L G L D L W Q V K S G T I F D N F L I T N D E A Y A E E F G N E T W G V T K T A E K Q M K D K Q D E E Q R L K E E E E E K K R K E E E E A E E D E E D K D D K E D E D E D E E D K D E E E E E A A A G Q A K D E L P L E Q K L I S E E D L N S A V D H H H H H H

    Read More

    Abcam Scientific Support

    Answered on Jul 21 2006

    Question

    Was the protein quantified for LPS after it was purified?

    Read More

    Abcam community

    Verified customer

    Asked on Jan 09 2006

    Answer

    Thank you for your enquiry and patience. Unfortunately, we don't have additional information regarding this product at this time. If we do receive such information, we will update the online datasheet. We do know that the recombinant calreticulin was expressed in E. coli and purified as His-tag protein. Full length cDNA encoding mature rabbit calreticulin was cloned into pBAD expression vector followed by expression in E. coli, cell lysis and affinity chromatography on Ni-column as described in (Guo et al., 2003). The protein has a C-terminal His-tag and has passed all biochemical tests in the lab to indicate that it is properly folded and functional. The best test for the quality of recombinant calreticulin involves limited proteolysis with trypsin as described in (Corbett et al., 2000). The final product is filter sterilized. Please contact us again if you have any additional questions.

    Read More

    Abcam Scientific Support

    Answered on Jan 23 2006

    Question

    We bought your product (ab15729).datasheet indicates the product is in liquid form. I need to know the formulation of the buffer.

    Read More

    Abcam community

    Verified customer

    Asked on Dec 08 2004

    Answer

    Thank you for your email. The buffer only consists of PBS, and there are no preservatives in the buffer. If you have any more questions, please contact us again.

    Read More

    Abcam Scientific Support

    Answered on Dec 08 2004

    Question

    Hi: I bought calrituculin protein (cat :ab15729-100) from your company, it is solution 1mg/ml. What kind of solution in it? Does it contain Calcium or Zinc? Please let me know as soon as you can. Thank you!

    Read More

    Abcam community

    Verified customer

    Asked on Nov 29 2004

    Answer

    My apologies for the delay in replying to your enquiry, we have just received the following information from the source of ab15729: "The protein is in PBS and we have not added any Ca or Zn to this solution. One may want to add a small amount of EGTA (0.05 uM) to chelate a residual Ca, if any. If there is any residual Ca present it would be in nanomolar concentration, a typical "contaminant" of any solution that does not contain a chelator. When we are interested in studying Ca effects on the protein we always add some EGTA to make sure we have full control of actual Ca concentration in the protein solution." I hope this information helps, please do not hesitate to contact us if you need further help,

    Read More

    Abcam Scientific Support

    Answered on Dec 06 2004

    Question

    From which species is the Calreticulin protein obtained?

    Read More

    Abcam community

    Verified customer

    Asked on Oct 21 2004

    Answer

    Thank you for your enquiry. Here are some details regarding this protein: Recombinant calreticulin was expressed in E. coli and purified as His-tag protein. Full length cDNA encoding mature rabbit calreticulin was cloned into pBAD expression vector followed by expression in E. coli, cell lysis and affinity chromatography on Ni-column as described in (Guo et al., 2003). The protein has a C-terminal His-tag and has passed all biochemical tests in the lab to indicate that it is properly folded and functional. The best test for the quality of recombinant calreticulin involves limited proteolysis with trypsin as described in (Corbett et al., 2000). The final product is filter sterilized.

    Read More

    Abcam Scientific Support

    Answered on Oct 22 2004

    Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
    For licensing inquiries, please contact partnerships@abcam.com

    Get resources and offers direct to your inbox Sign up
    A-Z by research area
    • Cancer
    • Cardiovascular
    • Cell biology
    • Developmental biology
    • Epigenetics & Nuclear signaling
    • Immunology
    • Metabolism
    • Microbiology
    • Neuroscience
    • Signal transduction
    • Stem cells
    A-Z by product type
    • Primary antibodies
    • Secondary antibodies
    • Biochemicals
    • Isotype controls
    • Flow cytometry multi-color selector
    • Kits
    • Loading controls
    • Lysates
    • Peptides
    • Proteins
    • Slides
    • Tags and cell markers
    • Tools & Reagents
    Help & support
    • Support
    • Make an Inquiry
    • Protocols & troubleshooting
    • Placing an order
    • RabMAb products
    • Biochemical product FAQs
    • Training
    • Browse by Target
    Company
    • Corporate site
    • Investor relations
    • Company news
    • Careers
    • About us
    • Blog
    Events
    • Tradeshows
    • Conferences
    International websites
    • abcam.cn
    • abcam.co.jp

    Join with us

    • LinkedIn
    • facebook
    • Twitter
    • YouTube
    • Terms of sale
    • Website terms of use
    • Cookie policy
    • Privacy policy
    • Legal
    • Modern slavery statement
    © 1998-2023 Abcam plc. All rights reserved.