Recombinant Rabbit Calreticulin protein (ab15729)
Key features and details
- Expression system: Escherichia coli
- Suitable for: WB, ELISA
Description
-
Product name
Recombinant Rabbit Calreticulin protein
See all Calreticulin proteins and peptides -
Expression system
Escherichia coli -
Accession
-
Protein length
Full length protein -
Animal free
No -
Nature
Recombinant -
-
Species
Rabbit -
Sequence
MLLPVPLLLGLLGLAAAEPVVYFKEQFLDGDGWTERWIESKHKSDFGKFV LSSGKFYGDQEKDKGLQTSQDARFYALSARFEPFSNKGQPLVVQFTVKHE QNIDCGGGYVKLFPAGLDQKDMHGDSEYNIMFGPDICGPGTKKVHVIFNY KGKNVLINKDIRCKDDEFTHLYTLIVRPDNTYEVKIDNSQVESGSLEDDW DFLPPKKIKDPDASKPEDWDERAKIDDPTDSKPEDWDKPEHIPDPDAKKP EDWDEEMDGEWEPPVIQNPEYKGEWKPRQIDNPDYKGTWIHPEIDNPEYS PDANIYAYDSFAVLGLDLWQVKSGTIFDNFLITNDEAYAEEFGNETWGVT KTAEKQMKDKQDEEQRLKEEEEEKKRKEEEEAEEDEEDKDDKEDEDEDEE DKDEEEEEAAAGQAKDEL -
Predicted molecular weight
60 kDa -
Amino acids
1 to 418 -
Additional sequence information
Molecular weight based on amino acid composition. The protein migrates as ~60 KdA protein in the SDS-PAGE due to reduced SDS binding (highly acidic C-terminus).
-
Specifications
Our Abpromise guarantee covers the use of ab15729 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
-
Applications
Western blot
ELISA
-
Form
Liquid -
Additional notes
Purified full length rabbit Calreticulin protein. SwissProt ID P15253.
-
Concentration information loading...
Preparation and Storage
-
Stability and Storage
Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
Constituent: PBS
General Info
-
Alternative names
- Autoantigen RO
- CALR
- CALR protein
see all -
Function
Molecular calcium-binding chaperone promoting folding, oligomeric assembly and quality control in the ER via the calreticulin/calnexin cycle. This lectin interacts transiently with almost all of the monoglucosylated glycoproteins that are synthesized in the ER. Interacts with the DNA-binding domain of NR3C1 and mediates its nuclear export. -
Sequence similarities
Belongs to the calreticulin family. -
Domain
Can be divided into a N-terminal globular domain, a proline-rich P-domain forming an elongated arm-like structure and a C-terminal acidic domain. The P-domain binds one molecule of calcium with high affinity, whereas the acidic C-domain binds multiple calcium ions with low affinity.
The interaction with glycans occurs through a binding site in the globular lectin domain.
The zinc binding sites are localized to the N-domain.
Associates with PDIA3 through the tip of the extended arm formed by the P-domain. -
Cellular localization
Endoplasmic reticulum lumen. Cytoplasm > cytosol. Secreted > extracellular space > extracellular matrix. Cell surface. Also found in cell surface (T cells), cytosol and extracellular matrix. Associated with the lytic granules in the cytolytic T-lymphocytes. - Information by UniProt
Images
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
-
Datasheet download
References (4)
ab15729 has been referenced in 4 publications.
- Zhang Y et al. Engineering Calreticulin-Targeting Monobodies to Detect Immunogenic Cell Death in Cancer Chemotherapy. Cancers (Basel) 13:N/A (2021). PubMed: 34199835
- Ihara Y et al. Calnexin/Calreticulin and Assays Related to N-Glycoprotein Folding In Vitro. Methods Mol Biol 2132:295-308 (2020). PubMed: 32306337
- Dudek-Peric AM et al. Antitumor immunity triggered by melphalan is potentiated by melanoma cell surface-associated calreticulin. Cancer Res 75:1603-14 (2015). PubMed: 25762540
- Cheng WF et al. Tumor-specific immunity and antiangiogenesis generated by a DNA vaccine encoding calreticulin linked to a tumor antigen. J Clin Invest 108:669-78 (2001). PubMed: 11544272