Description

  • Product name

    Recombinant Rabbit CCL21 protein
    See all CCL21 proteins and peptides
  • Expression system

    Yeast
  • Accession

  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Rabbit
    • Sequence

      SDGGAQDCCLKYSLRKIPHKVVRSYRKQEPSLGCPISAILFSPRKRSQPE LCADPKEPWVQQLMKRLDRPPAPKKQVQACRKDGGASKSGKKGKGCKRTE QPQTPKGP
    • Predicted molecular weight

      12 kDa
    • Amino acids

      4 to 111

Specifications

Our Abpromise guarantee covers the use of ab204218 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.

    Constituents: 10% Trehalose, 90% PBS

General Info

  • Alternative names

    • 6Ckine
    • Beta chemokine exodus 2
    • Beta-chemokine exodus-2
    • C C motif chemokine ligand 21
    • C-C motif chemokine 21
    • CCL21
    • CCL21_HUMAN
    • Chemokine (C-C motif) ligand 21
    • Chemokine CC motif ligand 21
    • CKb9
    • ECL
    • Efficient Chemoattractant for Lymphocytes
    • SCYA21
    • Secondary lymphoid tissue chemokine
    • Secondary lymphoid-tissue chemokine
    • SLC
    • Small inducible cytokine A21
    • Small inducible cytokine subfamily A (Cys-Cys), member 21
    • Small-inducible cytokine A21
    • TCA4
    • UNQ784/PRO1600
    see all
  • Function

    Inhibits hemopoiesis and stimulates chemotaxis. Chemotactic in vitro for thymocytes and activated T-cells, but not for B-cells, macrophages, or neutrophils. Shows preferential activity towards naive T-cells. May play a role in mediating homing of lymphocytes to secondary lymphoid organs.
  • Tissue specificity

    Highly expressed in high endothelial venules of lymph nodes, spleen and appendix. Intermediate levels found in small intestine, thyroid gland and trachea. Low level expression in thymus, bone marrow, liver, and pancreas. Also found in tonsil, fetal heart and fetal spleen.
  • Sequence similarities

    Belongs to the intercrine beta (chemokine CC) family.
  • Cellular localization

    Secreted.
  • Information by UniProt

References

ab204218 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab204218.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up