Description

  • Product name

    Recombinant Rabbit GM-CSF protein
    See all GM-CSF proteins and peptides
  • Purity

    > 95 % SDS-PAGE.
    ab209131 was purified by Ion-exchange chromatography.
  • Expression system

    Yeast
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Rabbit
    • Sequence

      APTHQPNTVSQPLKHVDAIKEARIILSRSNDSATVLGEMVEVVSEMFDPQ KPTCLQTRLELYKQGLRGSLERLSSTLTLMASHYKQNCPPTPETSCETEF ITFKSFKENLKCFLFVIPFNCWEPVQK
    • Predicted molecular weight

      14 kDa
    • Amino acids

      18 to 144
    • Additional sequence information

      This product is the mature full length protein from aa 18 to 144. The signal peptide is not included.

Specifications

Our Abpromise guarantee covers the use of ab209131 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Lyophilised
  • Additional notes

    ab209131 was produced in yeast and therefore does not have endotoxin, is naturally folded, and post-translationally modified. It can be used in cell culture, as an GM-CSF ELISA Standard, and as a Western Blot Control.

    seq 100% homologue to unreviewed swissprot, that i have entered in peptide page as entrez gene code link does not work in preview page (that by default sends to to swissprot).

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon reconsitution add a carrier protein (0.1% BSA). Store at -20°C. Avoid freeze / thaw cycle.

    Constituents: 90% PBS, 10% Trehalose

  • Reconstitution
    Reconstitute with sterile phosphate-buffered saline containing at least 0.1% carrier protein.

General Info

  • Alternative names

    • Colony stimulating factor
    • Colony Stimulating Factor 2
    • Colony stimulating factor 2 (granulocyte-macrophage)
    • Colony-stimulating factor
    • CSF
    • CSF 2
    • CSF2
    • CSF2_HUMAN
    • GM-CSF
    • GMCSF
    • Granulocyte Macrophage Colony Stimulating Factor
    • Granulocyte-macrophage colony-stimulating factor
    • MGC131935
    • MGC138897
    • MGI1GM
    • Molgramostin
    • Pluripoietin-a
    • Sargramostim
    see all
  • Function

    Cytokine that stimulates the growth and differentiation of hematopoietic precursor cells from various lineages, including granulocytes, macrophages, eosinophils and erythrocytes.
  • Sequence similarities

    Belongs to the GM-CSF family.
  • Cellular localization

    Secreted.
  • Information by UniProt

References

ab209131 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab209131.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up