Overview

Description

  • Nature

    Recombinant
  • Source

    Mammalian
  • Amino Acid Sequence
    • Accession
    • Species

      Rabbit
    • Sequence

      ADEIAKAQVARPGGDTIFGKIIRKEIPAKIIFEDDQCLAFHDISPQAPTH FLVIPKKHISQISAAEDADESLLGHLMIVGKKCAADLGLKKGYRMVVNEG SDGGQSVYHVHLHVLGGRQMNWPPG
    • Molecular weight

      18 kDa including tags
    • Amino acids

      2 to 126
    • Tags

      His tag N-Terminus
    • Additional sequence information

      10xHis-SUMO tag at the N-terminus and a Myc tag at the C-terminus.

Specifications

Our Abpromise guarantee covers the use of ab225961 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Purity

    > 90 % SDS-PAGE.

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    Constituents: 50% Glycerol, Tris buffer

General Info

  • Alternative names

    • Adenosine 5' monophosphoramidase
    • Adenosine 5''-monophosphoramidase
    • HINT 1
    • HINT1
    • HINT1_HUMAN
    • Histidine triad nucleotide binding protein 1
    • Histidine triad nucleotide-binding protein 1
    • PKCI 1
    • PKCI-1
    • PKCI1
    • PRKCNH1
    • Protein kinase C inhibitor 1
    • Protein kinase C interacting protein 1
    • Protein kinase C-interacting protein 1
    see all
  • Function

    Hydrolyzes adenosine 5'-monophosphoramidate substrates such as AMP-morpholidate, AMP-N-alanine methyl ester, AMP-alpha-acetyl lysine methyl ester and AMP-NH2.
  • Tissue specificity

    Widely expressed.
  • Sequence similarities

    Belongs to the HINT family.
    Contains 1 HIT domain.
  • Domain

    The histidine triad, also called HIT motif, forms part of the binding loop for the alpha-phosphate of purine mononucleotide.
  • Cellular localization

    Cytoplasm. Nucleus. Interaction with CDK7 leads to a more nuclear localization.
  • Information by UniProt

References

ab225961 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab225961.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up