Recombinant Rabbit IL-8 protein (ab222165)
Key features and details
- Expression system: Yeast
- Purity: > 95% Ion Exchange Chromatography
- Suitable for: SDS-PAGE
Description
-
Product name
Recombinant Rabbit IL-8 protein
See all IL-8 proteins and peptides -
Purity
> 95 % Ion Exchange Chromatography. -
Expression system
Yeast -
Accession
-
Protein length
Full length protein -
Animal free
No -
Nature
Recombinant -
-
Species
Rabbit -
Sequence
AVLTRIGTELRCQCIKTHSTPFHPKFIKELRVIESGPHCANSEIIVKLVD GRELCLDPKEKWVQKVVQIFLKRAEQQES -
Predicted molecular weight
9 kDa -
Amino acids
23 to 101 -
Additional sequence information
This product is the mature full length protein from aa 23 to 101. The signal peptide is not included.
-
Associated products
Specifications
Our Abpromise guarantee covers the use of ab222165 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
-
Applications
SDS-PAGE
-
Form
Lyophilized -
Concentration information loading...
Preparation and Storage
-
Stability and Storage
Shipped at 4°C. Upon reconsitution add a carrier protein (0.1% BSA). Store at -20°C long term. Avoid freeze / thaw cycle. Stable for 12 months at -20°C. Working aliquots stored with a carrier protein are stable for at least 3 months at -20°C to -80°C..
Constituents: PBS, 10% Trehalose
-
ReconstitutionReconstitute with sterile phosphate-buffered saline containing at least 0.1% carrier protein.
General Info
-
Alternative names
- (Ala-IL-8)77
- (Ser-IL-8)72
- 9E3
see all -
Function
IL-8 is a chemotactic factor that attracts neutrophils, basophils, and T-cells, but not monocytes. It is also involved in neutrophil activation. It is released from several cell types in response to an inflammatory stimulus. IL-8(6-77) has a 5-10-fold higher activity on neutrophil activation, IL-8(5-77) has increased activity on neutrophil activation and IL-8(7-77) has a higher affinity to receptors CXCR1 and CXCR2 as compared to IL-8(1-77), respectively. -
Sequence similarities
Belongs to the intercrine alpha (chemokine CxC) family. -
Post-translational
modificationsSeveral N-terminal processed forms are produced by proteolytic cleavage after secretion from at least peripheral blood monocytes, leukcocytes and endothelial cells. In general, IL-8(1-77) is referred to as interleukin-8. IL-8(6-77) is the most promiment form. -
Cellular localization
Secreted. - Information by UniProt
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
References (0)
ab222165 has not yet been referenced specifically in any publications.