Overview

Description

  • Nature

    Recombinant
  • Source

    Insect cells
  • Amino Acid Sequence
    • Species

      Rabbit
    • Sequence

      MSHELHGVSDASNCGCLNGGTCVTYKYFSNIWRCNCPKKFQGEHCEIDTL KTCYHGDGHSYRGKANTDIMDRPCLAWNSANVLTKTYHAHRPDALQLGLG KHNYCRNPDHQRRPWCYVQVGLKQLIQECKVHDCSSGKKPALPPGKLEFQ CGQKALRPRFKIIGGEFTIIENQPWFAAIYRRHRGGSVTYVCGGSLISPC
    • Amino acids

      21 to 433

Specifications

Our Abpromise guarantee covers the use of ab92603 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Biological activity

    Activity: 200,000 IU/mg (Relative to WHO International Standard for Human High Molecular Weight Urokinase, NIBSC 87/594)
  • Applications

    Functional Studies

    SDS-PAGE

  • Purity

    > 95 % SDS-PAGE.

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 5.00
    Constituents: 0.41% Sodium acetate, 0.0292% EDTA, 0.58% Sodium chloride

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

General Info

  • Alternative names

    • ATF
    • ATF uPA
    • BDPLT5
    • Plasminogen activator
    • Plasminogen activator urinary
    • Plasminogen activator urokinase
    • PLAU
    • QPD
    • u PA
    • U plasminogen activator
    • u-PA
    • U-plasminogen activator
    • uPA
    • URK
    • UROK_HUMAN
    • Urokinase plasminogen activator
    • Urokinase type plasminogen activator
    • Urokinase type plasminogen activator precursor
    • Urokinase-type plasminogen activator chain B
    see all
  • Function

    Specifically cleave the zymogen plasminogen to form the active enzyme plasmin.
  • Tissue specificity

    Expressed in the prostate gland and prostate cancers.
  • Sequence similarities

    Belongs to the peptidase S1 family.
    Contains 1 EGF-like domain.
    Contains 1 kringle domain.
    Contains 1 peptidase S1 domain.
  • Post-translational
    modifications

    Phosphorylation of Ser-158 and Ser-323 abolishes proadhesive ability but does not interfere with receptor binding.
  • Cellular localization

    Secreted.
  • Information by UniProt

Images

  • 10% SDS-PAGE showing ab92603
    Lane 1 Urokinase Non-reduced (3µg)
    Lane 2 Urokinase Reduced (3µg)

References

ab92603 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab92603.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up