Description

  • Product name

    Recombinant Rabies Virus Glycoprotein (His tag)
  • Purity

    > 90 % SDS-PAGE.

  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Sequence

      KFPIYTILDKLGPWSPIDIHHLSCPNNLVVEDEGCTNLSGFSYMELKVGY ILAIKMNGFTCTGVVTEAETYTNFVGYVTTTFKRKHFRPTPDACRAAYNW KMAGDPRYEESLHNPYPDYRWLRTVKTTKESLVIISPSVADLDPYDRSLH SRVFPSGKCSGVAVSSTYCSTNHDYTIWMPENPRLGMSCDIFTNSRGKRA SKGSETCGFVDERGLYKSLKGACKLKLCGVLGLRLMDGTWVAMQTSNETK WCPPDQLVNLHDFRSDEIEHLVVEELVRKREECLDALESIMTTKSVSFRR LSHLRKLVPGFGKAYTIFNKTLMEADAHYKSVRTWNEILPSKGCLRVGGR CHPHVNGVFFNGIILGPDGNVLIPEMQSSLLQQHMELLESSVIPLVHPLA DPSTVFKDGDEAEDFVEVHLPDVHNQVSGVDLGLPNWGKY
    • Predicted molecular weight

      66 kDa including tags
    • Amino acids

      20 to 459
    • Tags

      His tag N-Terminus
    • Additional sequence information

      Rabies virus (strain PM) (RABV). 6xHis-SUMO tag at the N-terminus.

Specifications

Our Abpromise guarantee covers the use of ab225663 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    Constituents: 50% Glycerol, Tris buffer

General Info

  • Alternative names

    • Glycoprotein G
  • Relevance

    The rabies virus is neurotrophic virus that causes fatal disease in human and animals. Rabies transmission can occur through the saliva of animals. It has a cylindrical morophology and is the type species of the Lyssavirus genus of the Rhabdoviridae family. These viruses are enveloped and have a single stranded RNA genome with negative-sense. The rabies virus is a member of the Lyssavirus genus. This genus of RNA viruses also includes the Aravan virus, Australian bat lyssavirus, Duvenhage virus, European bat lyssavirus 1, European bat lyssavirus 2, Irkut virus, Khujand virus, Lagos bat virus, Mokola virus and the West Caucasian bat virus. Together with the Vesiculovirus and others they form the Rhabdoviridae family.
  • Cellular localization

    Virion membrane; Single-pass type I membrane protein

Images

  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

References

ab225663 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab225663.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up