Description

  • Product name

    Recombinant Rat ADAM17 protein (His tag)
    See all ADAM17 proteins and peptides
  • Purity

    > 90 % SDS-PAGE.

  • Endotoxin level

    < 1.000 Eu/µg
  • Expression system

    HEK 293 cells
  • Accession

  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Rat
    • Sequence

      PRPPEEPGSGSHLRLEKLDSLLSDYDILSLSNIQQHSIRKRDLQSATHLE TLLTFSALKRHFKLYLTSSTERFSQNLRVVVVDGKEESEYSVKWQDFFSG HVVGEPDSRVLAHIGDDDVTVRINTDGAEYNIEPLWRFVNDTKDKRMLVY KSEDIKDFSRLQSPKVCGYLNADSEELLPKGLIDREPSEEFVRRVKRRAE PNPLKNTCKLLVVADHRFYKYMGRGEESTTTNYLIELIDRVDDIYRNTSW DNAGFKGYGVQIEQIRILKSPQEVKPGERHFNMAKSFPNEEKDAWDVKML LEQFSLDIAEEASKVCLAHLFTYQDFDMGTLGLAYVGSPRANSHGGVCPK AYYNPGVKKNIYLNSGLTSTKNYGKTILTKEADLVTTHELGHNFGAEHDP DGLAECAPNEDQGGKYVMYPIAVSGDHENNKMFSNCSKQSIYKTIESKAQ ECFQERSNKVCGNSRVDEGEECDPGIMYLNNDTCCNSDCTLKPGVQCSDR NSPCCKNCQFETAQKKCQEAINATCKGVSYCTGNSSECPPPGDAED
    • Predicted molecular weight

      63 kDa including tags
    • Amino acids

      18 to 563
    • Tags

      His tag C-Terminus
    • Additional sequence information

      NP_064702.

Specifications

Our Abpromise guarantee covers the use of ab219881 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -80°C. Avoid freeze / thaw cycle.

    pH: 6.50
    Constituents: 0.98% MES, 0.87% Sodium chloride, 5% Trehalose

    Lyophilized from 0.22 µm filtered solution.
    5-10% trehalose is commonly used for freeze drying, and after reconstitution, the trehalose is mostly about 3-5%

  • Reconstitution
    It is recommended to reconstitute the lyophilized product in sterile deionized water to a final concentration of 1 mg/ml. Solubilize for 30 to 60 minutes at room temperature with occasional gentle mixing. Carrier protein (0.1% HSA or BSA) is strongly recommended for further dilution and long term storage.

General Info

  • Alternative names

    • A disintegrin and metalloproteinase domain 17
    • A disintegrin and metalloproteinase domain 17 (tumor necrosis factor, alpha, converting enzyme)
    • ADA17_HUMAN
    • ADAM 17
    • ADAM metallopeptidase domain 17
    • ADAM17
    • ADAM17 protein
    • CD 156b
    • CD156b
    • CD156b antigen
    • CSVP
    • Disintegrin and metalloproteinase domain-containing protein 17
    • MGC71942
    • NISBD
    • NISBD1
    • Snake venom like protease
    • Snake venom-like protease
    • TACE
    • TNF alpha convertase
    • TNF alpha converting enzyme
    • TNF-alpha convertase
    • TNF-alpha-converting enzyme
    • Tumor Necrosis Factor Alpha Converting Enzyme
    see all
  • Function

    Cleaves the membrane-bound precursor of TNF-alpha to its mature soluble form. Responsible for the proteolytical release of soluble JAM3 from endothelial cells surface. Responsible for the proteolytic release of several other cell-surface proteins, including p75 TNF-receptor, interleukin 1 receptor type II, p55 TNF-receptor, transforming growth factor-alpha, L-selectin, growth hormone receptor, MUC1 and the amyloid precursor protein. Also involved in the activation of Notch pathway.
  • Tissue specificity

    Ubiquitously expressed. Expressed at highest levels in adult heart, placenta, skeletal muscle, pancreas, spleen, thymus, prostate, testes, ovary and small intestine, and in fetal brain, lung, liver and kidney.
  • Sequence similarities

    Contains 1 disintegrin domain.
    Contains 1 peptidase M12B domain.
  • Domain

    Must be membrane anchored to cleave the different substrates. The cytoplasmic domain is not required for the this activity. Only the catalytic domain is essential to shed TNF and p75 TNFR.
    The conserved cysteine present in the cysteine-switch motif binds the catalytic zinc ion, thus inhibiting the enzyme. The dissociation of the cysteine from the zinc ion upon the activation-peptide release activates the enzyme.
  • Post-translational
    modifications

    The precursor is cleaved by a furin endopeptidase.
    Phosphorylated. Stimulation by growth factor or phorbol 12-myristate 13-acetate induces phosphorylation of Ser-819 but decreases phosphorylation of Ser-791.
  • Cellular localization

    Membrane.
  • Information by UniProt

Images

  • DTT-reduced SDS-PAGE analysis of ab219881 stained overnight with Coomassie Blue.

    DTT-reduced protein migrates as 19 kDa and 20 kDa (Propeptide), 55-66 kDa (Mature-ADAM17) and 75-94 kDa (Pro-ADAM17) in SDS-PAGE due to glycosylation.

References

ab219881 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab219881.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up