Overview

Description

  • Nature

    Recombinant
  • Source

    Baculovirus infected Sf9 cells
  • Amino Acid Sequence
    • Accession
    • Species

      Rat
    • Sequence

      MDNNMDSKSILEELLLKKSQQKKKMSPINYKERLFVLTKTSLSYYEYDKM KRGSRKGSIEVKKIRCVEKVNLEEQTPVERQYPFQIVYKDGLLYVYASNE ESRCQWLKALQKEIRGNPHLLIKYHSGFFVDGKFLCCQQSCKAAPGCTLW EAYADLHIAISDEKHRAPTFPERILKIPRAVPILKMDASSSSAIPPQYDS HLKKSYDSQPTVNIRYIPREDCPDWWQIRKPKSEEDIARSNQLERNIVSH SPSKMSWGFPESSSSEEEENLDAYDWFAGNISRSQSEQLLRQKGKEGAFM VRNSSQMGMYTVSLFSKAVNDKKGTVKHYHVHTNAENKLYLAENYCFDSI PKLIHYHQHNSAGMITRLRHPVSTKANKVPVSVALGSGIWELKREEIALL KELGSGQFGVVQLGKWKGQYSVAVKMIKEGAMSEDEFFQEAQTMMKLSHP KLVKFYGVCSKKYPIYIVTEYITNGCLLNYLKNHGKGLESSQLLEMCYDV CEGMAFLESHQFIHRDLAARNCLVDSDLSVKVSDFGMTRYVLDDQYVSSV GTKFPVKWSAPEVFHYFKYSSKSDVWAFGILMWEVFSLGKQPYDLYDNSE VVVKVSQGHRLYRPQLASDTIYQIMYSCWHELPEKRPTFQQLLSAIEPLR EQDKP
    • Molecular weight

      110 kDa including tags
    • Amino acids

      1 to 655
    • Tags

      GST tag N-Terminus

Associated products

Specifications

Our Abpromise guarantee covers the use of ab207940 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Biological activity

    The specific activity of ab207940 was found to be 20 nmol/min/mg.

  • Applications

    SDS-PAGE

    Functional Studies

  • Purity

    > 85 % Densitometry.

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on Dry Ice. Upon delivery aliquot. Store at -80°C. Avoid freeze / thaw cycle.

    pH: 7.5
    Constituents: 0.79% Tris HCl, 0.87% Sodium chloride, 0.31% Glutathione, 0.003% EDTA, 0.002% PMSF, 0.004% DTT, 25% Glycerol

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

General Info

  • Alternative names

    • Bmx
    • BMX non receptor tyrosine kinase
    • BMX_HUMAN
    • BONE MARROW KINASE, X-LINKED
    • Bone marrow tyrosine kinase gene in chromosome X protein
    • Cytoplasmic tyrosine protein kinase BMX
    • Cytoplasmic tyrosine-protein kinase BMX
    • Epithelial and endothelial tyrosine kinase
    • ETK
    • NKT38
    • NTK 38
    • NTK38
    • Protein tyrosine kinase BMX
    • PSCTK 2
    • PSCTK 3
    • PSCTK2
    • PSCTK3
    see all
  • Function

    Activity is required for interleukin 6 (IL-6) induced differentiation. May play a role in the growth and differentiation of hematopoietic cells. May be involved in signal transduction in endocardial and arterial endothelial cells.
  • Tissue specificity

    Preferentially expressed in epithelial and endothelial cells.
  • Sequence similarities

    Belongs to the protein kinase superfamily. Tyr protein kinase family. TEC subfamily.
    Contains 1 Btk-type zinc finger.
    Contains 1 PH domain.
    Contains 1 protein kinase domain.
    Contains 1 SH2 domain.
  • Domain

    SH2 domain mediates interaction with RUFY1.
  • Cellular localization

    Cytoplasm.
  • Information by UniProt

Images

  • SDS-PAGE analysis of ab207940.

  • Sample Kinase Activity assay plot using ab207940.

References

ab207940 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab207940.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up