Description

  • Product name

    Recombinant rat BTK protein
    See all BTK proteins and peptides
  • Biological activity

    The specific activity of ab207956 was found to be 66 nmol/min/mg.

  • Purity

    > 95 % Densitometry.

  • Expression system

    Baculovirus infected Sf9 cells
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Rat
    • Sequence

      MAAVILESIFLKRSQQKKKTSPLNFKKRLFLLTVHKLSYYEYDFERGRRG SKKGSIDVEKITCVETVVPEKNPPPERQIPVPRGEESSEMEQISIIERFP YPFQVVYDEGPLYVFSPTEELRKRWIHQLKNVIRYNSDLVQKYHPCFWID GQYLCCSQTAKNAMGCQILENRNGSLKPGSSHRKTKKPLPPTPEEDQILK KPLPPEPTAAPISTSELKKVVALYDYMPMNANDLQLRKGEEYFILEESNL PWWRARDKNGQEGYIPSNYVTEAEDSIEMYEWYSKHMTRSQAEQLLKQEG KEGGFIVRDSSKAGKYTVSVFAKSTGEPQGVIRHYVVCSTPQSQYYLAEK HLFSTIPELINYHQHNSAGLISRLKYPVSKQNKNAPSTAGLGYGSWEIDP KDLTFLKELGTGQFGVVKYGKWRGQYDVAIKMIREGSMSEDEFIEEAKVM MNLSHEKLVQLYGVCTKQRPIFIITEYMAN GCLLNYLREMRHRFQTQQ LLEMCKDVCEAMEYLESKQFLHRDLAARNCLVNDQGVVKVSDFGLSRYVL DDEYTSSVGSKFPVRWSPPEVLMYSKFSSKSDIWAFGVLMWEIYSLGKIP YERFTNSETAEHIAQGLRLYRPHLASDRVYTIMYSCWHEKADERPSFKIL LSNILDVMDEES
    • Predicted molecular weight

      105 kDa including tags
    • Amino acids

      1 to 660
    • Tags

      GST tag N-Terminus
    • Additional sequence information

      NM_001007798.

Associated products

Specifications

Our Abpromise guarantee covers the use of ab207956 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Functional Studies

    SDS-PAGE

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on Dry Ice. Upon delivery aliquot. Store at -80°C. Avoid freeze / thaw cycle.

    pH: 7.0
    Preservative: 1.02% Imidazole
    Constituents: 0.82% Sodium phosphate, 1.74% Sodium chloride, 0.002% PMSF, 0.004% DTT, 25% Glycerol

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

General Info

  • Alternative names

    • Agammaglobulinaemia tyrosine kinase
    • AGMX 1
    • AGMX1
    • AT
    • ATK
    • B cell progenitor kinase
    • B-cell progenitor kinase
    • BPK
    • Bruton agammaglobulinemia tyrosine kinase
    • Bruton tyrosine kinase
    • Bruton’s Tyrosine Kinase
    • Btk
    • BTK_HUMAN
    • dominant-negative kinase-deficient Brutons tyrosine kinase
    • IMD 1
    • IMD1
    • MGC126261
    • MGC126262
    • OTTHUMP00000063593
    • PSCTK 1
    • PSCTK1
    • truncated Bruton agammaglobulinemia tyrosine kinase
    • Tyrosine protein kinase BTK
    • Tyrosine-protein kinase BTK
    • tyrosine-protein kinase BTK isoform (lacking exon 14
    • XLA
    see all
  • Function

    Plays a crucial role in B-cell ontogeny. Transiently phosphorylates GTF2I on tyrosine residues in response to B-cell receptor cross-linking. Required for the formation of functional ARID3A DNA-binding complexes.
  • Involvement in disease

    Defects in BTK are the cause of X-linked agammaglobulinemia (XLA) [MIM:300755]; also known as X-linked agammaglobulinemia type 1 (AGMX1) or immunodeficiency type 1 (IMD1). XLA is a humoral immunodeficiency disease which results in developmental defects in the maturation pathway of B-cells. Affected boys have normal levels of pre-B-cells in their bone marrow but virtually no circulating mature B-lymphocytes. This results in a lack of immunoglobulins of all classes and leads to recurrent bacterial infections like otitis, conjunctivitis, dermatitis, sinusitis in the first few years of life, or even some patients present overwhelming sepsis or meningitis, resulting in death in a few hours. Treatment in most cases is by infusion of intravenous immunoglobulin.
    Defects in BTK may be the cause of X-linked hypogammaglobulinemia and isolated growth hormone deficiency (XLA-IGHD) [MIM:307200]; also known as agammaglobulinemia and isolated growth hormone deficiency or Fleisher syndrome or isolated growth hormone deficiency type 3 (IGHD3). In rare cases XLA is inherited together with isolated growth hormone deficiency (IGHD).
  • Sequence similarities

    Belongs to the protein kinase superfamily. Tyr protein kinase family. TEC subfamily.
    Contains 1 Btk-type zinc finger.
    Contains 1 PH domain.
    Contains 1 protein kinase domain.
    Contains 1 SH2 domain.
    Contains 1 SH3 domain.
  • Post-translational
    modifications

    Autophosphorylated on Tyr-223 and Tyr-551. Phosphorylation of Tyr-223 may create a docking site for a SH2 containing protein.
  • Cellular localization

    Cytoplasm. Membrane. Nucleus.
  • Information by UniProt

Images

  • SDS-PAGE analysis of ab207956.

  • Sample Kinase Activity assay plot using ab207956 showing the specific activity to be 66 nmol/min/mg.

References

ab207956 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab207956.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up